Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6141
Gene name
Locationscaffold_522:650..1679
Strand-
Gene length (bp)1029
Transcript length (bp)504
Coding sequence length (bp)501
Protein length (aa) 167

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01655 Ribosomal_L32e Ribosomal protein L32 6.0E-49 51 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RXY1|RL32_NEUCR 60S ribosomal protein L32 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-63 PE=3 SV=1 37 167 2.0E-79
sp|P79015|RL32A_SCHPO 60S ribosomal protein L32-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3202 PE=1 SV=2 44 166 4.0E-57
sp|O42935|RL32B_SCHPO 60S ribosomal protein L32-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3201 PE=3 SV=1 44 166 4.0E-56
sp|Q751I7|RL32_ASHGO 60S ribosomal protein L32 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL32 PE=3 SV=1 37 166 3.0E-53
sp|Q6FS03|RL32_CANGA 60S ribosomal protein L32 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL32 PE=3 SV=1 37 166 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RXY1|RL32_NEUCR 60S ribosomal protein L32 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-63 PE=3 SV=1 37 167 2.0E-79
sp|P79015|RL32A_SCHPO 60S ribosomal protein L32-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3202 PE=1 SV=2 44 166 4.0E-57
sp|O42935|RL32B_SCHPO 60S ribosomal protein L32-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3201 PE=3 SV=1 44 166 4.0E-56
sp|Q751I7|RL32_ASHGO 60S ribosomal protein L32 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL32 PE=3 SV=1 37 166 3.0E-53
sp|Q6FS03|RL32_CANGA 60S ribosomal protein L32 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL32 PE=3 SV=1 37 166 2.0E-52
sp|Q94460|RL32_DROAC 60S ribosomal protein L32 OS=Drosophila acanthoptera GN=RpL32 PE=2 SV=1 46 166 7.0E-51
sp|P61127|RL32_DROYA 60S ribosomal protein L32 OS=Drosophila yakuba GN=RpL32 PE=2 SV=1 46 166 9.0E-51
sp|P61128|RL32_DROSI 60S ribosomal protein L32 OS=Drosophila simulans GN=RpL32 PE=3 SV=1 46 166 9.0E-51
sp|P04359|RL32_DROME 60S ribosomal protein L32 OS=Drosophila melanogaster GN=RpL32 PE=1 SV=3 46 166 9.0E-51
sp|P38061|RL32_YEAST 60S ribosomal protein L32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL32 PE=1 SV=1 38 166 2.0E-50
sp|P84323|RL32_DROPS 60S ribosomal protein L32 OS=Drosophila pseudoobscura pseudoobscura GN=RpL32 PE=3 SV=1 46 166 4.0E-50
sp|P84327|RL32_DROPE 60S ribosomal protein L32 OS=Drosophila persimilis GN=RpL32 PE=3 SV=1 46 166 4.0E-50
sp|P84326|RL32_DROMI 60S ribosomal protein L32 OS=Drosophila miranda GN=RpL32 PE=3 SV=1 46 166 4.0E-50
sp|P84325|RL32_DROAZ 60S ribosomal protein L32 OS=Drosophila azteca GN=RpL32 PE=3 SV=1 46 166 4.0E-50
sp|P84324|RL32_DROAI 60S ribosomal protein L32 OS=Drosophila affinis GN=RpL32 PE=3 SV=1 46 166 4.0E-50
sp|P84312|RL32_DROBF 60S ribosomal protein L32 OS=Drosophila bifasciata GN=RpL32 PE=3 SV=1 46 166 5.0E-50
sp|P84314|RL32_DROGU 60S ribosomal protein L32 OS=Drosophila guanche GN=RpL32 PE=3 SV=1 46 166 5.0E-50
sp|P84311|RL32_DROSU 60S ribosomal protein L32 OS=Drosophila subobscura GN=RpL32 PE=3 SV=1 46 166 5.0E-50
sp|Q962T1|RL32_SPOFR 60S ribosomal protein L32 OS=Spodoptera frugiperda GN=RpL32 PE=2 SV=1 46 166 5.0E-50
sp|P84313|RL32_DROMD 60S ribosomal protein L32 OS=Drosophila madeirensis GN=RpL32 PE=3 SV=1 46 166 5.0E-50
sp|O94008|RL32_CANAX 60S ribosomal protein L32 OS=Candida albicans GN=RPL32 PE=3 SV=1 37 166 2.0E-49
sp|P62912|RL32_RAT 60S ribosomal protein L32 OS=Rattus norvegicus GN=Rpl32 PE=1 SV=2 46 166 3.0E-49
sp|Q6QAT0|RL32_PIG 60S ribosomal protein L32 OS=Sus scrofa GN=RPL32 PE=1 SV=3 46 166 3.0E-49
sp|P62911|RL32_MOUSE 60S ribosomal protein L32 OS=Mus musculus GN=Rpl32 PE=1 SV=2 46 166 3.0E-49
sp|Q76KA3|RL32_MACFA 60S ribosomal protein L32 OS=Macaca fascicularis GN=RPL32 PE=2 SV=3 46 166 3.0E-49
sp|P62910|RL32_HUMAN 60S ribosomal protein L32 OS=Homo sapiens GN=RPL32 PE=1 SV=2 46 166 3.0E-49
sp|E2RKA8|RL32_CANLF 60S ribosomal protein L32 OS=Canis lupus familiaris GN=RPL32 PE=1 SV=1 46 166 3.0E-49
sp|Q3SZQ6|RL32_BOVIN 60S ribosomal protein L32 OS=Bos taurus GN=RPL32 PE=2 SV=3 46 166 4.0E-49
sp|Q90YT6|RL32_ICTPU 60S ribosomal protein L32 OS=Ictalurus punctatus GN=rpl32 PE=2 SV=1 46 166 8.0E-49
sp|Q8WRF3|RL32_APIME 60S ribosomal protein L32 OS=Apis mellifera GN=RpL32 PE=2 SV=1 46 166 3.0E-48
sp|P49211|RL321_ARATH 60S ribosomal protein L32-1 OS=Arabidopsis thaliana GN=RPL32A PE=2 SV=2 46 166 2.0E-45
sp|Q9FHG2|RL322_ARATH 60S ribosomal protein L32-2 OS=Arabidopsis thaliana GN=RPL32B PE=2 SV=1 46 166 3.0E-44
sp|P17932|RL32P_MOUSE Putative 60S ribosomal protein L32' OS=Mus musculus GN=Rpl32-ps PE=5 SV=2 46 166 8.0E-44
sp|P34040|RL32_TRIHA 60S ribosomal protein L32 OS=Trichoderma harzianum GN=rpl32 PE=2 SV=1 37 143 1.0E-38
sp|Q55AB5|RL32_DICDI 60S ribosomal protein L32 OS=Dictyostelium discoideum GN=rpl32 PE=3 SV=1 54 166 8.0E-38
sp|Q8SS18|RL32_ENCCU 60S ribosomal protein L32 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL32 PE=3 SV=1 49 167 2.0E-29
sp|Q236T0|RL32_TETTS 60S ribosomal protein L32 OS=Tetrahymena thermophila (strain SB210) GN=RPL32 PE=1 SV=1 34 166 6.0E-29
sp|Q9HH82|RL32_PYRFU 50S ribosomal protein L32e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl32e PE=1 SV=1 47 160 1.0E-22
sp|O59435|RL32_PYRHO 50S ribosomal protein L32e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl32e PE=3 SV=1 47 160 5.0E-22
sp|C6A177|RL32_THESM 50S ribosomal protein L32e OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl32e PE=3 SV=1 53 160 1.0E-21
sp|Q9V1V2|RL32_PYRAB 50S ribosomal protein L32e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl32e PE=3 SV=1 47 160 1.0E-21
sp|Q8TW13|RL32_METKA 50S ribosomal protein L32e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl32 PE=3 SV=1 47 159 8.0E-21
sp|C5A268|RL32_THEGJ 50S ribosomal protein L32e OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl32e PE=3 SV=1 47 160 3.0E-20
sp|Q5JJG5|RL32_THEKO 50S ribosomal protein L32e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl32e PE=3 SV=1 47 158 2.0E-19
sp|B6YSN1|RL32_THEON 50S ribosomal protein L32e OS=Thermococcus onnurineus (strain NA1) GN=rpl32e PE=3 SV=1 47 158 4.0E-19
sp|O26128|RL32_METTH 50S ribosomal protein L32e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl32e PE=3 SV=1 53 158 1.0E-17
sp|P54010|RL32_METJA 50S ribosomal protein L32e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl32e PE=3 SV=1 54 167 1.0E-16
sp|O05638|RL32_SULAC 50S ribosomal protein L32e OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl32e PE=3 SV=1 50 158 8.0E-16
sp|C3N5U4|RL32_SULIA 50S ribosomal protein L32e OS=Sulfolobus islandicus (strain M.16.27) GN=rpl32e PE=3 SV=1 47 158 8.0E-16
sp|C4KHH3|RL32_SULIK 50S ribosomal protein L32e OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl32e PE=3 SV=1 47 158 8.0E-16
sp|C3MQ76|RL32_SULIL 50S ribosomal protein L32e OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl32e PE=3 SV=1 47 158 8.0E-16
sp|C3MVJ5|RL32_SULIM 50S ribosomal protein L32e OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl32e PE=3 SV=1 47 158 8.0E-16
sp|C3NH92|RL32_SULIN 50S ribosomal protein L32e OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl32e PE=3 SV=1 47 158 8.0E-16
sp|C3NEG0|RL32_SULIY 50S ribosomal protein L32e OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl32e PE=3 SV=1 47 158 8.0E-16
sp|Q8PV33|RL32_METMA 50S ribosomal protein L32e OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl32e PE=3 SV=2 46 158 7.0E-15
sp|Q9UX90|RL32_SULSO 50S ribosomal protein L32e OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl32e PE=3 SV=1 47 158 1.0E-14
sp|Q8TRT0|RL32_METAC 50S ribosomal protein L32e OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl32e PE=3 SV=2 46 159 6.0E-14
sp|Q97BV9|RL32_THEVO 50S ribosomal protein L32e OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl32e PE=3 SV=1 49 158 1.0E-13
sp|Q9HIS4|RL32_THEAC 50S ribosomal protein L32e OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl32e PE=3 SV=1 46 160 6.0E-13
sp|Q975J7|RL32_SULTO 50S ribosomal protein L32e OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl32e PE=3 SV=1 54 159 9.0E-13
sp|Q8ZVV9|RL32_PYRAE 50S ribosomal protein L32e OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl32e PE=3 SV=1 54 163 3.0E-12
sp|O28371|RL32_ARCFU 50S ribosomal protein L32e OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl32e PE=3 SV=1 48 158 5.0E-12
sp|A4FWA4|RL32_METM5 50S ribosomal protein L32e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl32e PE=3 SV=1 47 166 6.0E-12
sp|A6VH02|RL32_METM7 50S ribosomal protein L32e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl32e PE=3 SV=1 47 166 9.0E-12
sp|A6UQ61|RL32_METVS 50S ribosomal protein L32e OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl32e PE=3 SV=1 47 166 2.0E-11
sp|P14549|RL32_METVA 50S ribosomal protein L32e OS=Methanococcus vannielii GN=rpl32e PE=3 SV=1 47 166 2.0E-11
sp|Q6LXD6|RL32_METMP 50S ribosomal protein L32e OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl32e PE=3 SV=1 47 166 6.0E-11
sp|A9A9P7|RL32_METM6 50S ribosomal protein L32e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl32e PE=3 SV=1 47 166 2.0E-10
sp|Q74MV8|RL32_NANEQ 50S ribosomal protein L32e OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl32e PE=3 SV=1 66 158 4.0E-10
sp|Q9YF92|RL32_AERPE 50S ribosomal protein L32e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl32e PE=3 SV=1 46 158 7.0E-10
sp|P12736|RL32_HALMA 50S ribosomal protein L32e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl32e PE=1 SV=3 53 158 3.0E-09
sp|Q6L1B0|RL32_PICTO 50S ribosomal protein L32e OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl32e PE=3 SV=1 47 158 3.0E-08
sp|Q9HPB7|RL32_HALSA 50S ribosomal protein L32e OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl32e PE=1 SV=3 51 158 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0006518 peptide metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0043603 cellular amide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019538 protein metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0005198 structural molecule activity No
GO:0043043 peptide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043604 amide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6141
MRGLVPSVRASLATGISPRDWNLTIAISLRNQPAVKMVAAKKHVPIVKKRTARFNRHQSDRFKCLSPSWRKPKGI
DNRVRRRFRGTMAMPSIGYGSNKKTRYMMPSGHKAFLVSNVKDVELLMMHNRTYAAEIAHNVSSRKRIEIIARAK
QLCVKVTNAKAKVTTEV
Coding >Ophio5|6141
ATGCGTGGGCTTGTGCCCTCTGTTCGCGCTAGTCTGGCTACCGGAATTTCACCACGCGACTGGAATCTGACGATA
GCCATCAGCCTCAGGAACCAACCCGCCGTCAAGATGGTCGCCGCGAAGAAGCACGTTCCGATCGTGAAGAAGCGC
ACCGCGCGCTTCAACCGACACCAAAGCGACCGCTTCAAATGCCTCAGCCCCAGCTGGCGCAAGCCCAAGGGCATC
GATAACCGCGTCCGGAGACGCTTCCGTGGCACCATGGCCATGCCCTCGATCGGTTACGGCTCCAACAAGAAGACG
CGCTACATGATGCCCTCGGGCCACAAGGCCTTCCTCGTCAGCAACGTCAAGGACGTCGAGCTGCTCATGATGCAT
AACCGGACGTACGCCGCTGAGATCGCCCACAACGTTTCGTCGAGGAAGCGCATCGAAATCATCGCCCGCGCCAAG
CAACTATGCGTCAAGGTCACAAACGCAAAGGCCAAGGTCACCACCGAGGTG
Transcript >Ophio5|6141
ATGCGTGGGCTTGTGCCCTCTGTTCGCGCTAGTCTGGCTACCGGAATTTCACCACGCGACTGGAATCTGACGATA
GCCATCAGCCTCAGGAACCAACCCGCCGTCAAGATGGTCGCCGCGAAGAAGCACGTTCCGATCGTGAAGAAGCGC
ACCGCGCGCTTCAACCGACACCAAAGCGACCGCTTCAAATGCCTCAGCCCCAGCTGGCGCAAGCCCAAGGGCATC
GATAACCGCGTCCGGAGACGCTTCCGTGGCACCATGGCCATGCCCTCGATCGGTTACGGCTCCAACAAGAAGACG
CGCTACATGATGCCCTCGGGCCACAAGGCCTTCCTCGTCAGCAACGTCAAGGACGTCGAGCTGCTCATGATGCAT
AACCGGACGTACGCCGCTGAGATCGCCCACAACGTTTCGTCGAGGAAGCGCATCGAAATCATCGCCCGCGCCAAG
CAACTATGCGTCAAGGTCACAAACGCAAAGGCCAAGGTCACCACCGAGGTGTAA
Gene >Ophio5|6141
ATGCGTGGTGCGGAGAAGTTGCTGATTGCTTACCGGGCGAGGTTCGGTCTGGCTGGATTTCTTTTCAGGGCTTGT
GCCCTCTGTTCGCGCTAGTCTGGCTACCGGGTGGGTACGGAAGGGAAGGCTTGGCGGAAAGGAGGAAGGGGGGGG
GGAGAGAAAGTCTAGTCACGTGCATGCAGCCCTAAGCCCTTGAGCCTTAACTCGCTCCCCGCTAGAATTTCACCA
CGCGACTGGAATCTGACGATAGCCATCAGCCTCAGGAACCAACCCGCCGTCAAGGTGAATGCCGCCGCCGCCAGT
GATATCGAAGCTGATATACTGACTTTGCGATAGATGGTCGCCGCGAAGAAGCACGTTCCGATCGTGAAGAAGCGT
ACGTATCGGGTCCTTTTTTCCCCAAAGAAATTGACGGCATCCGAGACCGGTCTCTTCTGCGACAGAAGAGAGCTA
GCTGCGTCATTGTCAGCTTTGAAAGAGGAGAGGAGTCCTAGCAGATTTTCTAGGAAGGATACCGACGAGGACCTC
CCGTTGACGTTTCAAAATACATACAGGCACCGCGCGCTTCAACCGACACCAAAGCGACCGCTTCAAATGCCTCAG
CCCCAGCTGGCGCAAGCCCAAGGGCATCGATAACCGCGTCCGGAGACGCTTCCGTGGCACCATGGCCATGCCCTC
GGTACGCGTTGGGCCCCCCCCACAAAGATTGCCCAGCCGCTGACAACCAAACACAGATCGGTTACGGCTCCAACA
AGAAGACGCGCTACATGATGCCCTCGGGCCACAAGGCCTTCCTCGTCAGCAACGTCAAGGACGTCGAGCTGCTCA
TGATGCATAACCGGACGTACGCCGCTGAGTACGTTGCTGACCAGCATGCCAACCTCGTCGCACTGATCGGGCACC
TCTGACGTTGACTATGGCAGGATCGCCCACAACGTTTCGTCGAGGAAGCGCATCGAAATCATCGCCCGCGCCAAG
CAACTATGCGTCAAGGTCACAAACGCAAAGGCCAAGGTCACCACCGAGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail