Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6121
Gene name
Locationscaffold_52:39604..41903
Strand+
Gene length (bp)2299
Transcript length (bp)1908
Coding sequence length (bp)1905
Protein length (aa) 635

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 3.0E-08 167 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 52 587 3.0E-23
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 40 521 9.0E-23
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 25 562 7.0E-17
sp|A5UF68|DNAK_HAEIG Chaperone protein DnaK OS=Haemophilus influenzae (strain PittGG) GN=dnaK PE=3 SV=1 53 426 2.0E-10
sp|P43736|DNAK_HAEIN Chaperone protein DnaK OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaK PE=3 SV=2 53 426 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 52 587 3.0E-23
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 40 521 9.0E-23
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 25 562 7.0E-17
sp|A5UF68|DNAK_HAEIG Chaperone protein DnaK OS=Haemophilus influenzae (strain PittGG) GN=dnaK PE=3 SV=1 53 426 2.0E-10
sp|P43736|DNAK_HAEIN Chaperone protein DnaK OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaK PE=3 SV=2 53 426 4.0E-10
sp|Q4QJW4|DNAK_HAEI8 Chaperone protein DnaK OS=Haemophilus influenzae (strain 86-028NP) GN=dnaK PE=3 SV=1 53 426 4.0E-10
sp|A5UBQ1|DNAK_HAEIE Chaperone protein DnaK OS=Haemophilus influenzae (strain PittEE) GN=dnaK PE=3 SV=1 53 426 5.0E-10
sp|B8F7S6|DNAK_HAEPS Chaperone protein DnaK OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaK PE=3 SV=1 53 422 1.0E-09
sp|B0BTI7|DNAK_ACTPJ Chaperone protein DnaK OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaK PE=3 SV=1 53 426 2.0E-09
sp|B3H2X7|DNAK_ACTP7 Chaperone protein DnaK OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dnaK PE=3 SV=1 53 426 2.0E-09
sp|A3N3K0|DNAK_ACTP2 Chaperone protein DnaK OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaK PE=3 SV=1 53 426 2.0E-09
sp|Q3IFG5|HSCA_PSEHT Chaperone protein HscA homolog OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=hscA PE=3 SV=1 38 440 6.0E-09
sp|O52064|DNAK_MANHA Chaperone protein DnaK OS=Mannheimia haemolytica GN=dnaK PE=3 SV=1 53 422 8.0E-09
sp|P39987|HSP7E_YEAST Heat shock protein SSC3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM10 PE=3 SV=1 53 422 1.0E-08
sp|P48209|DNAK_HAEDU Chaperone protein DnaK OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaK PE=3 SV=2 53 422 1.0E-08
sp|A8IPT1|DNAK_AZOC5 Chaperone protein DnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaK PE=3 SV=1 53 422 2.0E-08
sp|Q65U55|DNAK_MANSM Chaperone protein DnaK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaK PE=3 SV=2 53 422 4.0E-08
sp|Q30Q10|DNAK_SULDN Chaperone protein DnaK OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=dnaK PE=3 SV=1 53 407 4.0E-08
sp|B7VJT0|HSCA_VIBTL Chaperone protein HscA homolog OS=Vibrio tasmaniensis (strain LGP32) GN=hscA PE=3 SV=1 38 427 5.0E-08
sp|C4L8Y5|DNAK_TOLAT Chaperone protein DnaK OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaK PE=3 SV=1 53 407 5.0E-08
sp|A6VNB1|DNAK_ACTSZ Chaperone protein DnaK OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaK PE=3 SV=1 53 422 5.0E-08
sp|Q8Y0L9|HSCA_RALSO Chaperone protein HscA homolog OS=Ralstonia solanacearum (strain GMI1000) GN=hscA PE=3 SV=1 38 425 6.0E-08
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 54 427 1.0E-07
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 53 517 1.0E-07
sp|A8FYU0|DNAK_SHESH Chaperone protein DnaK OS=Shewanella sediminis (strain HAW-EB3) GN=dnaK PE=3 SV=1 53 420 2.0E-07
sp|A1B4E9|DNAK_PARDP Chaperone protein DnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=3 SV=1 53 408 2.0E-07
sp|B6YRF7|DNAK_AZOPC Chaperone protein DnaK OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=dnaK PE=3 SV=1 53 422 3.0E-07
sp|A7IC65|DNAK_XANP2 Chaperone protein DnaK OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaK PE=3 SV=1 53 422 4.0E-07
sp|Q7VQL4|DNAK_BLOFL Chaperone protein DnaK OS=Blochmannia floridanus GN=dnaK PE=3 SV=1 53 423 4.0E-07
sp|A3M561|HSCA_ACIBT Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hscA PE=3 SV=2 38 263 4.0E-07
sp|B0VD55|HSCA_ACIBY Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain AYE) GN=hscA PE=3 SV=1 38 263 4.0E-07
sp|B7I5P9|HSCA_ACIB5 Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain AB0057) GN=hscA PE=3 SV=1 38 263 4.0E-07
sp|B7H3H4|HSCA_ACIB3 Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain AB307-0294) GN=hscA PE=3 SV=1 38 263 4.0E-07
sp|B2HZI1|HSCA_ACIBC Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain ACICU) GN=hscA PE=3 SV=1 38 263 5.0E-07
sp|A6Q421|DNAK_NITSB Chaperone protein DnaK OS=Nitratiruptor sp. (strain SB155-2) GN=dnaK PE=3 SV=1 178 471 5.0E-07
sp|P71331|DNAK_AGGAC Chaperone protein DnaK OS=Aggregatibacter actinomycetemcomitans GN=dnaK PE=3 SV=3 53 425 5.0E-07
sp|A8FLH2|DNAK_CAMJ8 Chaperone protein DnaK OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=dnaK PE=3 SV=1 53 471 8.0E-07
sp|Q5HV33|DNAK_CAMJR Chaperone protein DnaK OS=Campylobacter jejuni (strain RM1221) GN=dnaK PE=3 SV=1 53 471 8.0E-07
sp|A1U614|DNAK_MARHV Chaperone protein DnaK OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaK PE=3 SV=1 53 471 9.0E-07
sp|Q086J3|DNAK_SHEFN Chaperone protein DnaK OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaK PE=3 SV=1 53 407 1.0E-06
sp|A5FZ19|DNAK_ACICJ Chaperone protein DnaK OS=Acidiphilium cryptum (strain JF-5) GN=dnaK PE=3 SV=1 166 471 1.0E-06
sp|A9AGU7|HSCA_BURM1 Chaperone protein HscA homolog OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hscA PE=3 SV=1 38 306 1.0E-06
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 53 471 1.0E-06
sp|B2U8U5|HSCA_RALPJ Chaperone protein HscA homolog OS=Ralstonia pickettii (strain 12J) GN=hscA PE=3 SV=1 38 422 1.0E-06
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 53 422 1.0E-06
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 53 471 2.0E-06
sp|Q0I3V2|DNAK_HAES1 Chaperone protein DnaK OS=Haemophilus somnus (strain 129Pt) GN=dnaK PE=3 SV=1 53 422 2.0E-06
sp|P55994|DNAK_HELPY Chaperone protein DnaK OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaK PE=3 SV=2 53 407 2.0E-06
sp|Q9ZMW4|DNAK_HELPJ Chaperone protein DnaK OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dnaK PE=3 SV=3 53 407 2.0E-06
sp|Q39EU4|HSCA_BURL3 Chaperone protein HscA homolog OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hscA PE=3 SV=1 38 428 2.0E-06
sp|Q17VY4|DNAK_HELAH Chaperone protein DnaK OS=Helicobacter acinonychis (strain Sheeba) GN=dnaK PE=3 SV=1 53 407 2.0E-06
sp|B1YT24|HSCA_BURA4 Chaperone protein HscA homolog OS=Burkholderia ambifaria (strain MC40-6) GN=hscA PE=3 SV=1 38 428 2.0E-06
sp|Q5B0C0|HSP7M_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN6010 PE=1 SV=1 53 471 2.0E-06
sp|B4EDS3|HSCA_BURCJ Chaperone protein HscA homolog OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hscA PE=3 SV=1 38 306 2.0E-06
sp|A7H484|DNAK_CAMJD Chaperone protein DnaK OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dnaK PE=3 SV=1 53 471 2.0E-06
sp|B2URT8|DNAK_HELPS Chaperone protein DnaK OS=Helicobacter pylori (strain Shi470) GN=dnaK PE=3 SV=1 53 407 3.0E-06
sp|A9HEA3|DNAK_GLUDA Chaperone protein DnaK OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaK PE=3 SV=1 178 471 3.0E-06
sp|Q5QXL1|DNAK_IDILO Chaperone protein DnaK OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaK PE=3 SV=1 167 407 3.0E-06
sp|Q1IT15|DNAK_KORVE Chaperone protein DnaK OS=Koribacter versatilis (strain Ellin345) GN=dnaK PE=3 SV=1 53 471 3.0E-06
sp|O69298|DNAK_CAMJE Chaperone protein DnaK OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dnaK PE=3 SV=1 53 471 3.0E-06
sp|B4S0U1|DNAK_ALTMD Chaperone protein DnaK OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=dnaK PE=3 SV=1 53 407 3.0E-06
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 54 422 3.0E-06
sp|B0UWR4|DNAK_HISS2 Chaperone protein DnaK OS=Histophilus somni (strain 2336) GN=dnaK PE=3 SV=1 53 422 3.0E-06
sp|A4Y9Q3|DNAK_SHEPC Chaperone protein DnaK OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaK PE=3 SV=1 53 407 3.0E-06
sp|A1RGN1|DNAK_SHESW Chaperone protein DnaK OS=Shewanella sp. (strain W3-18-1) GN=dnaK PE=3 SV=1 53 407 3.0E-06
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 166 471 4.0E-06
sp|A5CM86|DNAK_CLAM3 Chaperone protein DnaK OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=dnaK PE=3 SV=1 178 407 4.0E-06
sp|B0RBI1|DNAK_CLAMS Chaperone protein DnaK OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=dnaK PE=3 SV=1 178 407 4.0E-06
sp|P57870|DNAK_PASMU Chaperone protein DnaK OS=Pasteurella multocida (strain Pm70) GN=dnaK PE=3 SV=1 53 425 4.0E-06
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 53 422 5.0E-06
sp|A6QBG0|DNAK_SULNB Chaperone protein DnaK OS=Sulfurovum sp. (strain NBC37-1) GN=dnaK PE=3 SV=1 53 422 5.0E-06
sp|B1JV00|HSCA_BURCC Chaperone protein HscA homolog OS=Burkholderia cenocepacia (strain MC0-3) GN=hscA PE=3 SV=1 38 428 5.0E-06
sp|C3K275|DNAK_PSEFS Chaperone protein DnaK OS=Pseudomonas fluorescens (strain SBW25) GN=dnaK PE=3 SV=1 53 426 5.0E-06
sp|Q1LPL1|HSCA_CUPMC Chaperone protein HscA homolog OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hscA PE=3 SV=1 38 268 6.0E-06
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 53 422 6.0E-06
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 53 422 6.0E-06
sp|P95334|DNAK_MYXXD Chaperone protein DnaK OS=Myxococcus xanthus (strain DK 1622) GN=dnaK PE=3 SV=2 178 471 6.0E-06
sp|Q5FSL5|DNAK_GLUOX Chaperone protein DnaK OS=Gluconobacter oxydans (strain 621H) GN=dnaK PE=3 SV=1 166 471 6.0E-06
sp|O67118|DNAK_AQUAE Chaperone protein DnaK OS=Aquifex aeolicus (strain VF5) GN=dnaK PE=3 SV=1 171 422 6.0E-06
sp|A0K8P6|HSCA_BURCH Chaperone protein HscA homolog OS=Burkholderia cenocepacia (strain HI2424) GN=hscA PE=3 SV=1 38 428 6.0E-06
sp|Q1BHT5|HSCA_BURCA Chaperone protein HscA homolog OS=Burkholderia cenocepacia (strain AU 1054) GN=hscA PE=3 SV=1 38 428 6.0E-06
sp|B5Z9P0|DNAK_HELPG Chaperone protein DnaK OS=Helicobacter pylori (strain G27) GN=dnaK PE=3 SV=1 53 407 7.0E-06
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 53 422 7.0E-06
sp|B0TQC2|DNAK_SHEHH Chaperone protein DnaK OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaK PE=3 SV=1 53 407 7.0E-06
sp|B6JPL0|DNAK_HELP2 Chaperone protein DnaK OS=Helicobacter pylori (strain P12) GN=dnaK PE=3 SV=1 53 407 8.0E-06
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 53 422 8.0E-06
sp|A7HZ39|DNAK_PARL1 Chaperone protein DnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=3 SV=1 166 517 9.0E-06
sp|A9A135|DNAK_NITMS Chaperone protein DnaK OS=Nitrosopumilus maritimus (strain SCM1) GN=dnaK PE=3 SV=1 178 407 9.0E-06
sp|A0KMI6|DNAK_AERHH Chaperone protein DnaK OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaK PE=3 SV=1 53 407 9.0E-06
sp|A4G782|HSCA_HERAR Chaperone protein HscA homolog OS=Herminiimonas arsenicoxydans GN=hscA PE=3 SV=1 38 268 9.0E-06
sp|P20442|DNAK_CAUCR Chaperone protein DnaK OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaK PE=2 SV=2 53 422 1.0E-05
sp|Q1CV46|DNAK_HELPH Chaperone protein DnaK OS=Helicobacter pylori (strain HPAG1) GN=dnaK PE=3 SV=1 53 407 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0140657 ATP-dependent activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0030554 adenyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0044183 protein folding chaperone No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6121
MQASSGMSLKLPLRTSRGGSYFGSFAPPSSTEAINGPVREPVREQPPVGDRLIVGVDFGTTFSGVAAVYTSTPDD
VEIIKTWPGGNGITSDKVPTEIAYDTPTQDTDEPRTRWGFQFRPDESRLRCIKLFLDRSQKLPFYVSRHDTAAQL
KRYNKNVVDAVSDYLTQIYRHALDTLTRRYGESFMASTKVEFVLTCPAVWSDAAKNTTLLAAERAGMGSRSEIQM
ISEPEAAAVYTLKAIQPNHLNVGDNFIVCDAGGGTVDLIAYKIMSLKPLRVEESAVGTGGLCGSAFLNYRFEEHV
RNRLGVARFDEMKQRKGKTWQMGLRYFEEFVKRNFNEEEHHEVNVPFPGLADDEAAGLDSGFLVMTAAHIKEIFE
PVVKEVCDLVQGQVEGLRAKGGVVSGIVLVGGFGQSDFLYRQLKQHFTSAAPPPPYSERPTHAGAKAGDSNGSSS
IEVMQPVYAWTAVVRGAVLRGLEGSMVVSRKSRMHYGTSYATVFDEEKHSVCERYWSPLWERWMVSDRMQWHIAK
GESLSPLAPIAFHYTRNFRPGQSLVVTDDLMACEADEPPAAYTRNLVHVCTLTTDLNAVPRTLFTRLTTTRGVEF
DNLDFTLEMIVDSAGLGFELKVDGVRYGRVEAEFH
Coding >Ophio5|6121
ATGCAGGCCAGCAGCGGCATGAGCCTGAAGCTGCCGCTGCGGACGAGCCGCGGCGGGAGCTACTTTGGCAGCTTT
GCGCCTCCGAGCTCGACCGAGGCCATCAACGGGCCGGTGCGGGAACCGGTTCGGGAGCAGCCGCCTGTTGGCGAC
CGGTTGATTGTGGGTGTTGACTTTGGCACCACCTTTTCGGGGGTGGCGGCCGTCTACACTTCGACGCCCGACGAT
GTCGAGATCATCAAGACGTGGCCCGGCGGCAACGGCATCACCTCGGACAAGGTGCCTACGGAGATTGCATACGAC
ACACCGACGCAGGACACAGACGAGCCGAGGACACGTTGGGGCTTCCAGTTCCGACCGGACGAGTCACGACTACGA
TGCATCAAGCTGTTCCTCGACCGATCGCAGAAGCTACCCTTTTACGTGAGCCGACACGACACGGCGGCGCAGCTG
AAGCGATACAATAAGAATGTCGTCGACGCCGTCAGCGACTACCTCACGCAGATATACCGACATGCCCTGGACACG
CTGACGAGGCGGTACGGAGAGTCGTTCATGGCATCGACAAAGGTCGAGTTCGTCCTCACCTGTCCGGCCGTTTGG
AGTGACGCGGCGAAGAATACGACGCTGTTGGCGGCTGAGAGGGCCGGCATGGGCAGTAGGTCGGAGATCCAGATG
ATCAGCGAGCCTGAGGCGGCGGCTGTGTATACGCTCAAGGCGATTCAGCCGAATCATCTCAATGTGGGCGATAAT
TTTATCGTTTGCGACGCGGGGGGCGGAACGGTCGACCTCATCGCGTACAAAATCATGTCGCTCAAGCCGCTCCGG
GTTGAAGAATCGGCCGTCGGCACCGGCGGCCTCTGCGGCAGCGCCTTTCTCAACTATCGCTTCGAAGAGCACGTG
CGAAACAGGCTGGGCGTAGCCCGTTTCGATGAGATGAAGCAGCGCAAGGGAAAGACGTGGCAGATGGGACTGCGA
TACTTTGAGGAGTTTGTCAAGAGGAACTTTAACGAGGAGGAGCATCACGAGGTCAACGTGCCCTTCCCTGGCCTG
GCAGACGACGAAGCGGCAGGTCTAGACTCGGGCTTCCTCGTCATGACAGCCGCGCACATCAAAGAAATATTCGAA
CCGGTCGTCAAAGAAGTGTGCGACCTGGTGCAAGGCCAAGTAGAAGGGCTACGGGCCAAAGGCGGAGTCGTCTCC
GGCATCGTCCTAGTCGGCGGTTTCGGCCAGAGCGACTTCCTCTACCGGCAGCTGAAGCAGCATTTCACCAGCGCC
GCGCCGCCGCCGCCGTACAGCGAGAGGCCGACGCATGCGGGTGCCAAGGCGGGGGACTCGAACGGGTCGTCGTCG
ATCGAGGTGATGCAGCCCGTCTACGCCTGGACGGCCGTCGTTCGGGGCGCCGTGCTCAGGGGGTTGGAAGGGAGT
ATGGTGGTTTCGAGGAAGTCGCGGATGCATTACGGCACGTCGTATGCGACTGTCTTCGACGAGGAGAAGCATTCG
GTTTGTGAGAGGTATTGGTCTCCGCTGTGGGAGAGGTGGATGGTTTCGGATAGGATGCAGTGGCATATCGCCAAG
GGCGAATCCCTCTCCCCGCTGGCGCCCATCGCCTTCCACTACACGCGAAACTTCCGACCGGGCCAGTCTCTGGTG
GTGACGGACGACCTGATGGCTTGCGAAGCCGACGAGCCGCCGGCGGCTTACACCCGTAACCTGGTACACGTCTGC
ACGCTGACGACGGACCTGAACGCGGTGCCGAGGACCCTCTTCACCCGACTGACGACGACGAGAGGCGTCGAGTTT
GACAATTTGGACTTTACCCTCGAGATGATTGTCGATAGCGCCGGCCTGGGCTTTGAACTCAAGGTTGATGGGGTG
AGGTATGGTCGCGTCGAGGCGGAGTTTCAC
Transcript >Ophio5|6121
ATGCAGGCCAGCAGCGGCATGAGCCTGAAGCTGCCGCTGCGGACGAGCCGCGGCGGGAGCTACTTTGGCAGCTTT
GCGCCTCCGAGCTCGACCGAGGCCATCAACGGGCCGGTGCGGGAACCGGTTCGGGAGCAGCCGCCTGTTGGCGAC
CGGTTGATTGTGGGTGTTGACTTTGGCACCACCTTTTCGGGGGTGGCGGCCGTCTACACTTCGACGCCCGACGAT
GTCGAGATCATCAAGACGTGGCCCGGCGGCAACGGCATCACCTCGGACAAGGTGCCTACGGAGATTGCATACGAC
ACACCGACGCAGGACACAGACGAGCCGAGGACACGTTGGGGCTTCCAGTTCCGACCGGACGAGTCACGACTACGA
TGCATCAAGCTGTTCCTCGACCGATCGCAGAAGCTACCCTTTTACGTGAGCCGACACGACACGGCGGCGCAGCTG
AAGCGATACAATAAGAATGTCGTCGACGCCGTCAGCGACTACCTCACGCAGATATACCGACATGCCCTGGACACG
CTGACGAGGCGGTACGGAGAGTCGTTCATGGCATCGACAAAGGTCGAGTTCGTCCTCACCTGTCCGGCCGTTTGG
AGTGACGCGGCGAAGAATACGACGCTGTTGGCGGCTGAGAGGGCCGGCATGGGCAGTAGGTCGGAGATCCAGATG
ATCAGCGAGCCTGAGGCGGCGGCTGTGTATACGCTCAAGGCGATTCAGCCGAATCATCTCAATGTGGGCGATAAT
TTTATCGTTTGCGACGCGGGGGGCGGAACGGTCGACCTCATCGCGTACAAAATCATGTCGCTCAAGCCGCTCCGG
GTTGAAGAATCGGCCGTCGGCACCGGCGGCCTCTGCGGCAGCGCCTTTCTCAACTATCGCTTCGAAGAGCACGTG
CGAAACAGGCTGGGCGTAGCCCGTTTCGATGAGATGAAGCAGCGCAAGGGAAAGACGTGGCAGATGGGACTGCGA
TACTTTGAGGAGTTTGTCAAGAGGAACTTTAACGAGGAGGAGCATCACGAGGTCAACGTGCCCTTCCCTGGCCTG
GCAGACGACGAAGCGGCAGGTCTAGACTCGGGCTTCCTCGTCATGACAGCCGCGCACATCAAAGAAATATTCGAA
CCGGTCGTCAAAGAAGTGTGCGACCTGGTGCAAGGCCAAGTAGAAGGGCTACGGGCCAAAGGCGGAGTCGTCTCC
GGCATCGTCCTAGTCGGCGGTTTCGGCCAGAGCGACTTCCTCTACCGGCAGCTGAAGCAGCATTTCACCAGCGCC
GCGCCGCCGCCGCCGTACAGCGAGAGGCCGACGCATGCGGGTGCCAAGGCGGGGGACTCGAACGGGTCGTCGTCG
ATCGAGGTGATGCAGCCCGTCTACGCCTGGACGGCCGTCGTTCGGGGCGCCGTGCTCAGGGGGTTGGAAGGGAGT
ATGGTGGTTTCGAGGAAGTCGCGGATGCATTACGGCACGTCGTATGCGACTGTCTTCGACGAGGAGAAGCATTCG
GTTTGTGAGAGGTATTGGTCTCCGCTGTGGGAGAGGTGGATGGTTTCGGATAGGATGCAGTGGCATATCGCCAAG
GGCGAATCCCTCTCCCCGCTGGCGCCCATCGCCTTCCACTACACGCGAAACTTCCGACCGGGCCAGTCTCTGGTG
GTGACGGACGACCTGATGGCTTGCGAAGCCGACGAGCCGCCGGCGGCTTACACCCGTAACCTGGTACACGTCTGC
ACGCTGACGACGGACCTGAACGCGGTGCCGAGGACCCTCTTCACCCGACTGACGACGACGAGAGGCGTCGAGTTT
GACAATTTGGACTTTACCCTCGAGATGATTGTCGATAGCGCCGGCCTGGGCTTTGAACTCAAGGTTGATGGGGTG
AGGTATGGTCGCGTCGAGGCGGAGTTTCACTGA
Gene >Ophio5|6121
ATGCAGGCCAGCAGCGGCATGAGCCTGAAGCTGCCGCTGCGGACGAGCCGCGGCGGGAGCTACTTTGGCAGCTTT
GCGCCTCCGAGCTCGACCGAGGCCATCAACGGGCCGGTGCGGGAACCGGTTCGGGAGCAGCCGCCTGTTGGCGAC
CGGTTGATTGTGGGTGTTGACTTTGGCACCACCTTTTCGGGGTTGAGTCTCTCTTCTCTCTCTCTCTCTTTTTTT
TTTCTCCCTCTCCTCTTCTTCTTCTTTTTTCTCCCCCTTTGGACGCACGGCAGTAGCTGATAGCGAAAGGAATGA
GCAGGGTGGCGGCCGTCTACACTTCGACGCCCGACGATGTCGAGATCATCAAGACGTGGCCCGGCGGCAACGGCA
TCACCTCGGACAAGGTGCCTACGGAGATTGCATACGACACACCGACGCAGGACACAGACGAGCCGAGGACACGTT
GGGGCTTCCAGTTCCGACCGGACGAGTCACGACTACGATGCATCAAGCTGTTCCTCGACCGATCGCAGAAGCTAC
CCTTTTACGTGAGCCGACACGACACGGCGGCGCAGCTGAAGCGATACAATAAGAATGTCGTCGACGCCGTCAGCG
ACTACCTCACGCAGATATACCGACATGCCCTGGACACGCTGACGAGGCGGTACGGAGAGTCGTTCATGGCATCGA
CAAAGGTCGAGTTCGTCCTCACCTGTCCGGCCGTTTGGAGTGACGCGGCGAAGAATACGACGCTGTTGGCGGCTG
AGAGGGCCGGCATGGGCAGTAGGTCGGAGATCCAGATGATCAGCGAGCCTGAGGCGGCGGCTGTGTATACGCTCA
AGGCGATTCAGCCGAATCATCTCAATGTGGGCGATAATTTTATCGTTTGCGACGCGGGGGGCGGAACGGTCGAGT
GAGTCTCTTCTCCCGCCCTTTCCCCCCCCCCCCCCCTTTCTTCATCTTGTATTACTGAAGAGTGAGAGTCCTCCT
CTTGTGTTATCTTGATCTCTTGATCTGTTTTTTTTTTGGTCGTCATCGAAAGCTGACGGGGGTTTGTCGACAGCC
TCATCGCGTACAAAATCATGTCGCTCAAGCCGCTCCGGGTTGAAGAATCGGCCGTCGGCACCGGCGGCCTCTGCG
GCAGCGCCTTTCTCAACTATCGCTTCGAAGAGCACGTGCGAAACAGGCTGGGCGTAGCCCGTTTCGATGAGATGA
AGCAGCGCAAGGGAAAGACGTGGCAGATGGGACTGCGATACTTTGAGGAGTTTGTCAAGAGGAACTTTAACGAGG
AGGAGCATCACGAGGTCAACGTGCCGTACGTCTCCCCCCCCCCTTTTTTTTTTTTTTTGCCCCTTTCTTTTTTTC
TTTTGTCTGAGAAGAGAAGCACGACAGGCAGAGGAAAGGAACAGGGCAAGGATCATCATCTAACCGTGAAACGCG
CAGCTTCCCTGGCCTGGCAGACGACGAAGCGGCAGGTCTAGACTCGGGCTTCCTCGTCATGACAGCCGCGCACAT
CAAAGAAATATTCGAACCGGTCGTCAAAGAAGTGTGCGACCTGGTGCAAGGCCAAGTAGAAGGGCTACGGGCCAA
AGGCGGAGTCGTCTCCGGCATCGTCCTAGTCGGCGGTTTCGGCCAGAGCGACTTCCTCTACCGGCAGCTGAAGCA
GCATTTCACCAGCGCCGCGCCGCCGCCGCCGTACAGCGAGAGGCCGACGCATGCGGGTGCCAAGGCGGGGGACTC
GAACGGGTCGTCGTCGATCGAGGTGATGCAGCCCGTCTACGCCTGGACGGCCGTCGTTCGGGGCGCCGTGCTCAG
GGGGTTGGAAGGGAGTATGGTGGTTTCGAGGAAGTCGCGGATGCATTACGGCACGTCGTATGCGACTGTCTTCGA
CGAGGAGAAGCATTCGGTTTGTGAGAGGTATTGGTCTCCGCTGTGGGAGAGGTGGATGGTTTCGGATAGGATGCA
GTGGCATATCGCCAAGGGCGAATCCCTCTCCCCGCTGGCGCCCATCGCCTTCCACTACACGCGAAACTTCCGACC
GGGCCAGTCTCTGGTGGTGACGGACGACCTGATGGCTTGCGAAGCCGACGAGCCGCCGGCGGCTTACACCCGTAA
CCTGGTACACGTCTGCACGCTGACGACGGACCTGAACGCGGTGCCGAGGACCCTCTTCACCCGACTGACGACGAC
GAGAGGCGTCGAGTTTGACAATTTGGACTTTACCCTCGAGATGATTGTCGATAGCGCCGGCCTGGGCTTTGAACT
CAAGGTTGATGGGGTGAGGTATGGTCGCGTCGAGGCGGAGTTTCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail