Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|612
Gene name
Locationscaffold_116:39144..39857
Strand+
Gene length (bp)713
Transcript length (bp)642
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 8.1E-10 21 85

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59UT5|PGA7_CANAL Predicted GPI-anchored protein 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA7 PE=1 SV=1 23 171 6.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|612
MKTTFAALAVVGFAVAQDFAGQPPCAVGCLRDAIPQVGCKVEDTACACKPDTQARLMGVVAPCILSKCKPEEVNQ
AQGAARAACAKIGAQTQSAASSRAMASASQSAMQSGSSTQMGAITVTTMTGTAVTATATATGSSSASDSDDDNST
ATGGESSESGSATDSNASDQATSTGGSSRSSSSRAASPSSTGAAAGGPVTGAFAAILAAALAL
Coding >Ophio5|612
ATGAAGACCACCTTCGCTGCCCTTGCCGTCGTCGGCTTCGCTGTCGCTCAGGACTTTGCTGGACAGCCGCCCTGC
GCTGTCGGCTGCCTTCGCGATGCTATCCCTCAGGTCGGCTGCAAGGTCGAGGACACGGCCTGCGCTTGCAAGCCC
GATACTCAGGCTCGGCTCATGGGCGTCGTCGCCCCTTGCATCCTTAGCAAGTGCAAGCCCGAGGAGGTGAACCAG
GCTCAGGGAGCTGCCAGGGCCGCTTGCGCCAAGATCGGAGCTCAGACTCAGTCGGCCGCCTCGTCTCGGGCCATG
GCCTCTGCCTCGCAATCTGCCATGCAGTCTGGTTCCTCTACCCAGATGGGAGCCATCACCGTCACGACGATGACG
GGCACTGCCGTCACCGCCACTGCTACCGCCACCGGCTCCAGCTCTGCCTCGGACTCGGACGACGACAACTCTACT
GCTACCGGCGGCGAATCGTCCGAGTCTGGTAGCGCTACTGACTCCAACGCCTCCGACCAGGCCACCAGCACCGGC
GGCTCTTCTAGGTCGAGCAGCTCTCGTGCCGCCTCGCCCAGCTCCACTGGTGCTGCGGCGGGTGGACCCGTCACC
GGCGCCTTTGCTGCTATCCTGGCTGCTGCCCTGGCCTTG
Transcript >Ophio5|612
ATGAAGACCACCTTCGCTGCCCTTGCCGTCGTCGGCTTCGCTGTCGCTCAGGACTTTGCTGGACAGCCGCCCTGC
GCTGTCGGCTGCCTTCGCGATGCTATCCCTCAGGTCGGCTGCAAGGTCGAGGACACGGCCTGCGCTTGCAAGCCC
GATACTCAGGCTCGGCTCATGGGCGTCGTCGCCCCTTGCATCCTTAGCAAGTGCAAGCCCGAGGAGGTGAACCAG
GCTCAGGGAGCTGCCAGGGCCGCTTGCGCCAAGATCGGAGCTCAGACTCAGTCGGCCGCCTCGTCTCGGGCCATG
GCCTCTGCCTCGCAATCTGCCATGCAGTCTGGTTCCTCTACCCAGATGGGAGCCATCACCGTCACGACGATGACG
GGCACTGCCGTCACCGCCACTGCTACCGCCACCGGCTCCAGCTCTGCCTCGGACTCGGACGACGACAACTCTACT
GCTACCGGCGGCGAATCGTCCGAGTCTGGTAGCGCTACTGACTCCAACGCCTCCGACCAGGCCACCAGCACCGGC
GGCTCTTCTAGGTCGAGCAGCTCTCGTGCCGCCTCGCCCAGCTCCACTGGTGCTGCGGCGGGTGGACCCGTCACC
GGCGCCTTTGCTGCTATCCTGGCTGCTGCCCTGGCCTTGTAG
Gene >Ophio5|612
ATGAAGACCACCTTCGCTGCCCTTGCCGTCGTCGGCTTCGCTGTCGCTCAGGACTTTGCTGGACAGCCGCCCTGC
GCTGTATGCCTTGAAACCCACCCGGTCATCTAACCTGTCTCGTCCTGTCATGTACTAACCATTCTCCTTTCTAGG
TCGGCTGCCTTCGCGATGCTATCCCTCAGGTCGGCTGCAAGGTCGAGGACACGGCCTGCGCTTGCAAGCCCGATA
CTCAGGCTCGGCTCATGGGCGTCGTCGCCCCTTGCATCCTTAGCAAGTGCAAGCCCGAGGAGGTGAACCAGGCTC
AGGGAGCTGCCAGGGCCGCTTGCGCCAAGATCGGAGCTCAGACTCAGTCGGCCGCCTCGTCTCGGGCCATGGCCT
CTGCCTCGCAATCTGCCATGCAGTCTGGTTCCTCTACCCAGATGGGAGCCATCACCGTCACGACGATGACGGGCA
CTGCCGTCACCGCCACTGCTACCGCCACCGGCTCCAGCTCTGCCTCGGACTCGGACGACGACAACTCTACTGCTA
CCGGCGGCGAATCGTCCGAGTCTGGTAGCGCTACTGACTCCAACGCCTCCGACCAGGCCACCAGCACCGGCGGCT
CTTCTAGGTCGAGCAGCTCTCGTGCCGCCTCGCCCAGCTCCACTGGTGCTGCGGCGGGTGGACCCGTCACCGGCG
CCTTTGCTGCTATCCTGGCTGCTGCCCTGGCCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail