Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6114
Gene name
Locationscaffold_52:22371..23108
Strand-
Gene length (bp)737
Transcript length (bp)642
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74903|YCS3_SCHPO Uncharacterized calcium-binding protein C613.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.03 PE=3 SV=1 37 211 4.0E-32
sp|P39931|SS120_YEAST Protein SSP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSP120 PE=1 SV=1 38 175 5.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6114
MRASSLVSSPVALASIFIALAPNVVFGHGGNDAQKPVVDNSAQVDWMTRHMAEEHHITTWDAESFFSLHDYNVDG
VWQADEIQRTYGLLDPSNKDMSHERKEQVTRDLMAMLDTDGDSVVTLAEWKAFLAKGKTLPDMGTGSGHHGDDEY
EYEIHHWQKYHDEHTKLEDLTHPEDIEHFKKHEEQEKAEEAQKALDQKSIVEENIPSKFRRRD
Coding >Ophio5|6114
ATGCGCGCCTCCTCCCTCGTCTCCTCGCCCGTGGCCCTCGCCAGCATCTTCATCGCCCTCGCACCCAACGTCGTC
TTCGGTCATGGCGGTAACGACGCGCAGAAGCCCGTGGTGGACAACTCGGCCCAGGTCGATTGGATGACTAGACAC
ATGGCAGAGGAGCATCACATCACCACCTGGGACGCCGAGTCCTTCTTTAGTCTACACGACTACAACGTCGACGGC
GTCTGGCAGGCCGACGAGATTCAGCGCACCTACGGCCTCCTGGACCCTTCCAACAAGGACATGTCGCACGAGCGC
AAGGAGCAGGTGACGCGCGACTTGATGGCCATGCTCGATACCGACGGTGACTCTGTCGTCACCCTCGCCGAGTGG
AAGGCCTTCCTCGCAAAGGGTAAGACGCTACCCGATATGGGCACCGGCTCCGGCCACCATGGCGATGATGAGTAC
GAGTATGAGATCCACCACTGGCAAAAGTATCACGACGAGCACACCAAACTCGAGGACTTGACCCATCCCGAAGAC
ATTGAGCACTTCAAGAAGCATGAGGAGCAGGAGAAGGCCGAAGAGGCGCAGAAGGCCCTGGACCAGAAGTCGATT
GTCGAGGAGAACATCCCAAGCAAGTTCCGCCGGCGGGAT
Transcript >Ophio5|6114
ATGCGCGCCTCCTCCCTCGTCTCCTCGCCCGTGGCCCTCGCCAGCATCTTCATCGCCCTCGCACCCAACGTCGTC
TTCGGTCATGGCGGTAACGACGCGCAGAAGCCCGTGGTGGACAACTCGGCCCAGGTCGATTGGATGACTAGACAC
ATGGCAGAGGAGCATCACATCACCACCTGGGACGCCGAGTCCTTCTTTAGTCTACACGACTACAACGTCGACGGC
GTCTGGCAGGCCGACGAGATTCAGCGCACCTACGGCCTCCTGGACCCTTCCAACAAGGACATGTCGCACGAGCGC
AAGGAGCAGGTGACGCGCGACTTGATGGCCATGCTCGATACCGACGGTGACTCTGTCGTCACCCTCGCCGAGTGG
AAGGCCTTCCTCGCAAAGGGTAAGACGCTACCCGATATGGGCACCGGCTCCGGCCACCATGGCGATGATGAGTAC
GAGTATGAGATCCACCACTGGCAAAAGTATCACGACGAGCACACCAAACTCGAGGACTTGACCCATCCCGAAGAC
ATTGAGCACTTCAAGAAGCATGAGGAGCAGGAGAAGGCCGAAGAGGCGCAGAAGGCCCTGGACCAGAAGTCGATT
GTCGAGGAGAACATCCCAAGCAAGTTCCGCCGGCGGGATTGA
Gene >Ophio5|6114
ATGCGCGCCTCCTCCCTCGTCTCCTCGCCCGTGGCCCTCGCCAGCATCTTCATCGCCCTCGCACCCAACGTCGTC
TTCGGTCATGGCGGTAACGACGCGCAGAAGCCCGTGGTGGACAACTCGGCCCAGGTCGATTGGATGACTAGACAC
ATGGCAGGCATGCCTCCTCTTTGTCAACTTCGTTCTCGCAGTTGCTTCCCCTAGGGCGTAGGCGGGAGAAGCTGA
CAACCCTCTTCCTTCTTCGTAAAACAGAGGAGCATCACATCACCACCTGGGACGCCGAGTCCTTCTTTAGTCTAC
ACGACTACAACGTCGACGGCGTCTGGCAGGCCGACGAGATTCAGCGCACCTACGGCCTCCTGGACCCTTCCAACA
AGGACATGTCGCACGAGCGCAAGGAGCAGGTGACGCGCGACTTGATGGCCATGCTCGATACCGACGGTGACTCTG
TCGTCACCCTCGCCGAGTGGAAGGCCTTCCTCGCAAAGGGTAAGACGCTACCCGATATGGGCACCGGCTCCGGCC
ACCATGGCGATGATGAGTACGAGTATGAGATCCACCACTGGCAAAAGTATCACGACGAGCACACCAAACTCGAGG
ACTTGACCCATCCCGAAGACATTGAGCACTTCAAGAAGCATGAGGAGCAGGAGAAGGCCGAAGAGGCGCAGAAGG
CCCTGGACCAGAAGTCGATTGTCGAGGAGAACATCCCAAGCAAGTTCCGCCGGCGGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail