Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6113
Gene name
Locationscaffold_52:21091..22267
Strand+
Gene length (bp)1176
Transcript length (bp)1176
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02475 Met_10 Met-10+ like-protein 6.8E-05 155 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09832|TYW2_SCHPO tRNA wybutosine-synthesizing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm12 PE=3 SV=1 42 379 4.0E-64
sp|Q04235|TYW2_YEAST tRNA wybutosine-synthesizing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM12 PE=1 SV=1 34 384 9.0E-51
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 151 380 1.0E-18
sp|Q0P466|TYW2_DANRE tRNA wybutosine-synthesizing protein 2 homolog OS=Danio rerio GN=trmt12 PE=2 SV=1 30 379 3.0E-13
sp|Q4R3U8|TYW2_MACFA tRNA wybutosine-synthesizing protein 2 homolog OS=Macaca fascicularis GN=TRMT12 PE=2 SV=2 149 328 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09832|TYW2_SCHPO tRNA wybutosine-synthesizing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm12 PE=3 SV=1 42 379 4.0E-64
sp|Q04235|TYW2_YEAST tRNA wybutosine-synthesizing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM12 PE=1 SV=1 34 384 9.0E-51
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 151 380 1.0E-18
sp|Q0P466|TYW2_DANRE tRNA wybutosine-synthesizing protein 2 homolog OS=Danio rerio GN=trmt12 PE=2 SV=1 30 379 3.0E-13
sp|Q4R3U8|TYW2_MACFA tRNA wybutosine-synthesizing protein 2 homolog OS=Macaca fascicularis GN=TRMT12 PE=2 SV=2 149 328 1.0E-07
sp|Q58D65|TYW2_BOVIN tRNA wybutosine-synthesizing protein 2 homolog OS=Bos taurus GN=TRMT12 PE=2 SV=1 151 328 1.0E-07
sp|Q4V8B8|TYW2_RAT tRNA wybutosine-synthesizing protein 2 homolog OS=Rattus norvegicus GN=Trmt12 PE=2 SV=2 151 328 2.0E-07
sp|Q53H54|TYW2_HUMAN tRNA wybutosine-synthesizing protein 2 homolog OS=Homo sapiens GN=TRMT12 PE=1 SV=1 149 328 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6113
MGPPRRRLGEPIQEAVEAWLSTLDVPDGQRKDDWFETLVRTVPRRFTVYEPMVLLPTGSFDGEAWKAELRRQDAD
SLAALWTGILREVATRRGGEERTTLTHLAINEAIPRHDGGPNGGEENILRAPVGLRVLWGDFGPDEHDNDDEGFD
DALWVSTKQNAILQTWAPRWTMFSRGNVKEKARLLRFPSASAESCCWAVDLYAGIGYFAFSFVALGMRVLCWEIN
QWSVEGLRRGARANGWNVRVVRGLELGLAPADLLAGGEEMIVFLESNEAALSRISQWQSLGLVRRVEHVNCGFLP
TSERTWSSAWQMTRLHPDASWLHLHENVSVDGIEARRQAVQRLVDDWSASDGGGRTSTVDHVERVKTFAPGVWHC
VFDVRINVAQTNDTWQ
Coding >Ophio5|6113
ATGGGTCCCCCTCGACGGCGCCTCGGCGAGCCAATCCAAGAGGCCGTCGAAGCCTGGCTCAGCACCCTCGACGTG
CCGGACGGTCAGCGGAAAGACGACTGGTTCGAGACGCTGGTGCGAACGGTACCGCGCCGCTTCACCGTCTACGAG
CCCATGGTGCTGCTCCCGACCGGCAGCTTCGACGGCGAGGCATGGAAGGCTGAGCTCCGGCGACAGGACGCCGAC
TCGCTCGCTGCTCTGTGGACGGGCATCCTACGCGAGGTCGCGACCAGGCGCGGCGGCGAAGAGAGGACGACGTTG
ACGCATCTAGCCATCAATGAGGCCATTCCTCGTCATGACGGGGGCCCAAACGGTGGTGAGGAGAATATCCTACGG
GCGCCGGTCGGACTGCGTGTGCTCTGGGGAGACTTTGGTCCGGACGAGCATGATAACGACGACGAGGGCTTCGAC
GACGCCCTTTGGGTTTCGACGAAGCAAAACGCCATCCTTCAGACTTGGGCCCCGCGCTGGACCATGTTCAGCCGC
GGAAACGTCAAGGAAAAGGCGCGGCTGCTGCGTTTCCCTTCCGCCTCGGCCGAGAGCTGCTGTTGGGCCGTCGAC
CTATACGCCGGCATCGGCTACTTCGCCTTCAGCTTCGTCGCCCTCGGCATGCGGGTGCTTTGCTGGGAGATTAAT
CAATGGAGCGTCGAGGGTCTGCGCCGCGGAGCCCGTGCCAACGGCTGGAACGTCCGAGTCGTTCGCGGCCTTGAG
CTGGGCCTCGCGCCGGCCGACTTGTTGGCTGGCGGGGAGGAGATGATCGTCTTCCTCGAGAGCAACGAGGCTGCG
CTGTCGAGGATCTCGCAGTGGCAGTCGCTGGGTCTCGTCCGGCGCGTCGAGCACGTCAATTGCGGCTTTCTGCCC
ACGAGCGAGCGGACTTGGTCGTCGGCTTGGCAGATGACCAGGCTTCACCCTGATGCGTCGTGGCTGCATCTGCAC
GAGAATGTTAGCGTCGACGGCATTGAAGCGAGACGACAGGCAGTACAGCGCCTGGTCGACGACTGGTCTGCGTCA
GACGGTGGCGGCAGGACGTCGACGGTTGACCATGTCGAGCGTGTCAAGACATTTGCTCCGGGCGTTTGGCACTGC
GTCTTTGACGTACGGATAAACGTCGCGCAAACAAATGATACATGGCAA
Transcript >Ophio5|6113
ATGGGTCCCCCTCGACGGCGCCTCGGCGAGCCAATCCAAGAGGCCGTCGAAGCCTGGCTCAGCACCCTCGACGTG
CCGGACGGTCAGCGGAAAGACGACTGGTTCGAGACGCTGGTGCGAACGGTACCGCGCCGCTTCACCGTCTACGAG
CCCATGGTGCTGCTCCCGACCGGCAGCTTCGACGGCGAGGCATGGAAGGCTGAGCTCCGGCGACAGGACGCCGAC
TCGCTCGCTGCTCTGTGGACGGGCATCCTACGCGAGGTCGCGACCAGGCGCGGCGGCGAAGAGAGGACGACGTTG
ACGCATCTAGCCATCAATGAGGCCATTCCTCGTCATGACGGGGGCCCAAACGGTGGTGAGGAGAATATCCTACGG
GCGCCGGTCGGACTGCGTGTGCTCTGGGGAGACTTTGGTCCGGACGAGCATGATAACGACGACGAGGGCTTCGAC
GACGCCCTTTGGGTTTCGACGAAGCAAAACGCCATCCTTCAGACTTGGGCCCCGCGCTGGACCATGTTCAGCCGC
GGAAACGTCAAGGAAAAGGCGCGGCTGCTGCGTTTCCCTTCCGCCTCGGCCGAGAGCTGCTGTTGGGCCGTCGAC
CTATACGCCGGCATCGGCTACTTCGCCTTCAGCTTCGTCGCCCTCGGCATGCGGGTGCTTTGCTGGGAGATTAAT
CAATGGAGCGTCGAGGGTCTGCGCCGCGGAGCCCGTGCCAACGGCTGGAACGTCCGAGTCGTTCGCGGCCTTGAG
CTGGGCCTCGCGCCGGCCGACTTGTTGGCTGGCGGGGAGGAGATGATCGTCTTCCTCGAGAGCAACGAGGCTGCG
CTGTCGAGGATCTCGCAGTGGCAGTCGCTGGGTCTCGTCCGGCGCGTCGAGCACGTCAATTGCGGCTTTCTGCCC
ACGAGCGAGCGGACTTGGTCGTCGGCTTGGCAGATGACCAGGCTTCACCCTGATGCGTCGTGGCTGCATCTGCAC
GAGAATGTTAGCGTCGACGGCATTGAAGCGAGACGACAGGCAGTACAGCGCCTGGTCGACGACTGGTCTGCGTCA
GACGGTGGCGGCAGGACGTCGACGGTTGACCATGTCGAGCGTGTCAAGACATTTGCTCCGGGCGTTTGGCACTGC
GTCTTTGACGTACGGATAAACGTCGCGCAAACAAATGATACATGGCAATAG
Gene >Ophio5|6113
ATGGGTCCCCCTCGACGGCGCCTCGGCGAGCCAATCCAAGAGGCCGTCGAAGCCTGGCTCAGCACCCTCGACGTG
CCGGACGGTCAGCGGAAAGACGACTGGTTCGAGACGCTGGTGCGAACGGTACCGCGCCGCTTCACCGTCTACGAG
CCCATGGTGCTGCTCCCGACCGGCAGCTTCGACGGCGAGGCATGGAAGGCTGAGCTCCGGCGACAGGACGCCGAC
TCGCTCGCTGCTCTGTGGACGGGCATCCTACGCGAGGTCGCGACCAGGCGCGGCGGCGAAGAGAGGACGACGTTG
ACGCATCTAGCCATCAATGAGGCCATTCCTCGTCATGACGGGGGCCCAAACGGTGGTGAGGAGAATATCCTACGG
GCGCCGGTCGGACTGCGTGTGCTCTGGGGAGACTTTGGTCCGGACGAGCATGATAACGACGACGAGGGCTTCGAC
GACGCCCTTTGGGTTTCGACGAAGCAAAACGCCATCCTTCAGACTTGGGCCCCGCGCTGGACCATGTTCAGCCGC
GGAAACGTCAAGGAAAAGGCGCGGCTGCTGCGTTTCCCTTCCGCCTCGGCCGAGAGCTGCTGTTGGGCCGTCGAC
CTATACGCCGGCATCGGCTACTTCGCCTTCAGCTTCGTCGCCCTCGGCATGCGGGTGCTTTGCTGGGAGATTAAT
CAATGGAGCGTCGAGGGTCTGCGCCGCGGAGCCCGTGCCAACGGCTGGAACGTCCGAGTCGTTCGCGGCCTTGAG
CTGGGCCTCGCGCCGGCCGACTTGTTGGCTGGCGGGGAGGAGATGATCGTCTTCCTCGAGAGCAACGAGGCTGCG
CTGTCGAGGATCTCGCAGTGGCAGTCGCTGGGTCTCGTCCGGCGCGTCGAGCACGTCAATTGCGGCTTTCTGCCC
ACGAGCGAGCGGACTTGGTCGTCGGCTTGGCAGATGACCAGGCTTCACCCTGATGCGTCGTGGCTGCATCTGCAC
GAGAATGTTAGCGTCGACGGCATTGAAGCGAGACGACAGGCAGTACAGCGCCTGGTCGACGACTGGTCTGCGTCA
GACGGTGGCGGCAGGACGTCGACGGTTGACCATGTCGAGCGTGTCAAGACATTTGCTCCGGGCGTTTGGCACTGC
GTCTTTGACGTACGGATAAACGTCGCGCAAACAAATGATACATGGCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail