Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6109
Gene name
Locationscaffold_52:13843..15385
Strand+
Gene length (bp)1542
Transcript length (bp)1542
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 4.7E-10 46 238
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.9E-08 43 237
PF00743 FMO-like Flavin-binding monooxygenase-like 3.0E-06 156 356
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 3.3E-07 124 237
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.2E-05 46 90

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 38 241 2.0E-20
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 38 241 2.0E-20
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 38 241 2.0E-20
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 27 242 4.0E-17
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 41 463 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 38 241 2.0E-20
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 38 241 2.0E-20
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 38 241 2.0E-20
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 27 242 4.0E-17
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 41 463 1.0E-16
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 41 444 1.0E-16
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 6 241 8.0E-15
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 43 403 5.0E-14
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 43 392 7.0E-14
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 43 242 1.0E-13
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 46 241 2.0E-12
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 43 241 3.0E-12
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 44 369 2.0E-11
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 36 241 2.0E-11
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 41 392 3.0E-11
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 42 368 3.0E-11
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 44 355 2.0E-10
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 44 355 2.0E-10
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 44 355 2.0E-10
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 46 366 9.0E-10
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 46 368 2.0E-09
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 46 356 3.0E-09
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 43 242 7.0E-09
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 36 241 2.0E-08
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 34 356 4.0E-08
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 34 235 9.0E-08
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 34 243 9.0E-08
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 29 241 3.0E-07
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 34 235 4.0E-07
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 43 218 5.0E-07
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 46 356 6.0E-07
sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 39 235 7.0E-07
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 34 237 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0050661 NADP binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0004497 monooxygenase activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 446 468 22
2 475 492 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 10.28 4.01 16.56
CcL In ants, during behavior modification 169.61 84.88 254.34
CcD In ants, recently dead 119.05 63.12 174.99

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.141533 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6109
MPLKSQPALDNPFTLLYQLLQWLVGKALSPRPPPANGTAQRPRIAVIGAGITGVTAASHICGHGFDAVIFEAGPE
EHVGGIWSRVNDTSGLQIHSLMYRFHPSVSWQQGYPDRGQIVAEVRRLWARYGLRDKTRFNVRVESVYRDGGSWI
VNDPENGRFDGVVVAVGTCGDVKMPPLAGADKFVGPVLHSSELSARAIDVTNKQVAIVGGGASAVEALEFAIAHK
AARVTVLSRSEKWIIPRDVIVDALLSFNILGRETCLSWIPEWILRRFFYGPELEELSPPSDKGFFTDTPMVNSDI
MTRLRDGRARWLRGDIEMLTEHAVVVNRRARGVPKNGPGHHESVVADVVVMATGFRRPSLSMLPDDCFVEPYQCP
NWYLQTFPPQHPSVSAINCTFVNAVGSVGNWHIGIYTRILLMFLVDPLTRPSPVWMRRWIDMTRFLKRGSPTAAF
DFFTYLELLWWFVFCVCFNPFRWKWAVFVFLGVGLGLPRAVTRREERLLNLQGYRLRDQGSSI
Coding >Ophio5|6109
ATGCCGCTCAAGTCGCAGCCCGCCCTCGATAACCCCTTCACCTTGCTGTACCAGCTGCTTCAATGGCTGGTAGGA
AAAGCCCTCTCACCGCGGCCACCACCGGCCAACGGAACGGCTCAGCGGCCGCGCATCGCCGTCATCGGAGCCGGC
ATCACGGGCGTGACGGCGGCCTCTCACATCTGCGGCCACGGCTTCGACGCCGTCATTTTCGAGGCCGGGCCCGAG
GAACACGTGGGCGGTATCTGGAGCCGGGTCAACGACACGTCGGGCCTACAGATTCATAGCCTCATGTATCGCTTC
CACCCGTCCGTCTCTTGGCAGCAGGGCTATCCGGACCGAGGCCAGATTGTGGCCGAGGTGCGCCGGCTGTGGGCG
CGGTACGGGCTGCGAGATAAGACTCGCTTCAACGTCCGGGTCGAGAGCGTCTATCGCGATGGCGGCAGCTGGATC
GTCAATGACCCGGAGAATGGACGGTTCGATGGCGTCGTCGTCGCTGTAGGGACCTGCGGAGACGTCAAGATGCCG
CCCCTGGCCGGAGCGGACAAGTTCGTTGGGCCCGTCCTTCACTCGAGCGAGCTCTCGGCCCGAGCCATCGACGTG
ACCAACAAGCAGGTGGCCATCGTCGGGGGCGGCGCCAGCGCAGTGGAAGCGCTCGAATTCGCCATAGCGCACAAG
GCGGCGCGCGTGACGGTGCTCTCTCGATCCGAGAAATGGATCATCCCGCGAGACGTCATCGTCGACGCACTGCTG
AGCTTCAATATCCTCGGCCGAGAGACGTGTCTGTCGTGGATCCCCGAGTGGATTCTGCGTCGCTTCTTCTACGGC
CCCGAGCTCGAGGAGCTGTCGCCGCCGTCGGACAAGGGCTTCTTCACCGACACGCCCATGGTCAACTCGGACATC
ATGACCCGTCTGCGCGATGGACGTGCTCGCTGGCTGCGCGGCGACATTGAGATGCTGACGGAGCATGCCGTCGTC
GTCAATCGTCGGGCCAGGGGCGTGCCCAAGAACGGCCCCGGCCATCACGAGAGCGTCGTCGCCGACGTTGTCGTC
ATGGCTACCGGCTTCCGTCGTCCCTCGCTGTCTATGCTGCCGGACGACTGCTTTGTCGAGCCTTACCAGTGCCCC
AACTGGTATCTGCAGACGTTTCCGCCCCAGCACCCGTCCGTTTCGGCCATCAACTGCACTTTTGTCAACGCCGTC
GGCTCTGTCGGCAATTGGCACATTGGCATCTACACTCGCATCTTGCTCATGTTCCTTGTCGACCCGCTCACGCGG
CCGAGCCCGGTCTGGATGCGCCGCTGGATCGACATGACGCGCTTCCTCAAGCGCGGCAGCCCGACGGCCGCCTTT
GACTTCTTCACCTATCTCGAGCTGCTGTGGTGGTTCGTCTTTTGCGTCTGCTTCAACCCCTTTCGCTGGAAGTGG
GCAGTCTTTGTCTTCCTGGGTGTAGGCCTGGGCCTGCCCCGTGCTGTGACGAGGCGTGAGGAAAGGCTGCTGAAT
TTGCAGGGCTACCGTCTTCGGGATCAGGGCTCCAGCATC
Transcript >Ophio5|6109
ATGCCGCTCAAGTCGCAGCCCGCCCTCGATAACCCCTTCACCTTGCTGTACCAGCTGCTTCAATGGCTGGTAGGA
AAAGCCCTCTCACCGCGGCCACCACCGGCCAACGGAACGGCTCAGCGGCCGCGCATCGCCGTCATCGGAGCCGGC
ATCACGGGCGTGACGGCGGCCTCTCACATCTGCGGCCACGGCTTCGACGCCGTCATTTTCGAGGCCGGGCCCGAG
GAACACGTGGGCGGTATCTGGAGCCGGGTCAACGACACGTCGGGCCTACAGATTCATAGCCTCATGTATCGCTTC
CACCCGTCCGTCTCTTGGCAGCAGGGCTATCCGGACCGAGGCCAGATTGTGGCCGAGGTGCGCCGGCTGTGGGCG
CGGTACGGGCTGCGAGATAAGACTCGCTTCAACGTCCGGGTCGAGAGCGTCTATCGCGATGGCGGCAGCTGGATC
GTCAATGACCCGGAGAATGGACGGTTCGATGGCGTCGTCGTCGCTGTAGGGACCTGCGGAGACGTCAAGATGCCG
CCCCTGGCCGGAGCGGACAAGTTCGTTGGGCCCGTCCTTCACTCGAGCGAGCTCTCGGCCCGAGCCATCGACGTG
ACCAACAAGCAGGTGGCCATCGTCGGGGGCGGCGCCAGCGCAGTGGAAGCGCTCGAATTCGCCATAGCGCACAAG
GCGGCGCGCGTGACGGTGCTCTCTCGATCCGAGAAATGGATCATCCCGCGAGACGTCATCGTCGACGCACTGCTG
AGCTTCAATATCCTCGGCCGAGAGACGTGTCTGTCGTGGATCCCCGAGTGGATTCTGCGTCGCTTCTTCTACGGC
CCCGAGCTCGAGGAGCTGTCGCCGCCGTCGGACAAGGGCTTCTTCACCGACACGCCCATGGTCAACTCGGACATC
ATGACCCGTCTGCGCGATGGACGTGCTCGCTGGCTGCGCGGCGACATTGAGATGCTGACGGAGCATGCCGTCGTC
GTCAATCGTCGGGCCAGGGGCGTGCCCAAGAACGGCCCCGGCCATCACGAGAGCGTCGTCGCCGACGTTGTCGTC
ATGGCTACCGGCTTCCGTCGTCCCTCGCTGTCTATGCTGCCGGACGACTGCTTTGTCGAGCCTTACCAGTGCCCC
AACTGGTATCTGCAGACGTTTCCGCCCCAGCACCCGTCCGTTTCGGCCATCAACTGCACTTTTGTCAACGCCGTC
GGCTCTGTCGGCAATTGGCACATTGGCATCTACACTCGCATCTTGCTCATGTTCCTTGTCGACCCGCTCACGCGG
CCGAGCCCGGTCTGGATGCGCCGCTGGATCGACATGACGCGCTTCCTCAAGCGCGGCAGCCCGACGGCCGCCTTT
GACTTCTTCACCTATCTCGAGCTGCTGTGGTGGTTCGTCTTTTGCGTCTGCTTCAACCCCTTTCGCTGGAAGTGG
GCAGTCTTTGTCTTCCTGGGTGTAGGCCTGGGCCTGCCCCGTGCTGTGACGAGGCGTGAGGAAAGGCTGCTGAAT
TTGCAGGGCTACCGTCTTCGGGATCAGGGCTCCAGCATCTGA
Gene >Ophio5|6109
ATGCCGCTCAAGTCGCAGCCCGCCCTCGATAACCCCTTCACCTTGCTGTACCAGCTGCTTCAATGGCTGGTAGGA
AAAGCCCTCTCACCGCGGCCACCACCGGCCAACGGAACGGCTCAGCGGCCGCGCATCGCCGTCATCGGAGCCGGC
ATCACGGGCGTGACGGCGGCCTCTCACATCTGCGGCCACGGCTTCGACGCCGTCATTTTCGAGGCCGGGCCCGAG
GAACACGTGGGCGGTATCTGGAGCCGGGTCAACGACACGTCGGGCCTACAGATTCATAGCCTCATGTATCGCTTC
CACCCGTCCGTCTCTTGGCAGCAGGGCTATCCGGACCGAGGCCAGATTGTGGCCGAGGTGCGCCGGCTGTGGGCG
CGGTACGGGCTGCGAGATAAGACTCGCTTCAACGTCCGGGTCGAGAGCGTCTATCGCGATGGCGGCAGCTGGATC
GTCAATGACCCGGAGAATGGACGGTTCGATGGCGTCGTCGTCGCTGTAGGGACCTGCGGAGACGTCAAGATGCCG
CCCCTGGCCGGAGCGGACAAGTTCGTTGGGCCCGTCCTTCACTCGAGCGAGCTCTCGGCCCGAGCCATCGACGTG
ACCAACAAGCAGGTGGCCATCGTCGGGGGCGGCGCCAGCGCAGTGGAAGCGCTCGAATTCGCCATAGCGCACAAG
GCGGCGCGCGTGACGGTGCTCTCTCGATCCGAGAAATGGATCATCCCGCGAGACGTCATCGTCGACGCACTGCTG
AGCTTCAATATCCTCGGCCGAGAGACGTGTCTGTCGTGGATCCCCGAGTGGATTCTGCGTCGCTTCTTCTACGGC
CCCGAGCTCGAGGAGCTGTCGCCGCCGTCGGACAAGGGCTTCTTCACCGACACGCCCATGGTCAACTCGGACATC
ATGACCCGTCTGCGCGATGGACGTGCTCGCTGGCTGCGCGGCGACATTGAGATGCTGACGGAGCATGCCGTCGTC
GTCAATCGTCGGGCCAGGGGCGTGCCCAAGAACGGCCCCGGCCATCACGAGAGCGTCGTCGCCGACGTTGTCGTC
ATGGCTACCGGCTTCCGTCGTCCCTCGCTGTCTATGCTGCCGGACGACTGCTTTGTCGAGCCTTACCAGTGCCCC
AACTGGTATCTGCAGACGTTTCCGCCCCAGCACCCGTCCGTTTCGGCCATCAACTGCACTTTTGTCAACGCCGTC
GGCTCTGTCGGCAATTGGCACATTGGCATCTACACTCGCATCTTGCTCATGTTCCTTGTCGACCCGCTCACGCGG
CCGAGCCCGGTCTGGATGCGCCGCTGGATCGACATGACGCGCTTCCTCAAGCGCGGCAGCCCGACGGCCGCCTTT
GACTTCTTCACCTATCTCGAGCTGCTGTGGTGGTTCGTCTTTTGCGTCTGCTTCAACCCCTTTCGCTGGAAGTGG
GCAGTCTTTGTCTTCCTGGGTGTAGGCCTGGGCCTGCCCCGTGCTGTGACGAGGCGTGAGGAAAGGCTGCTGAAT
TTGCAGGGCTACCGTCTTCGGGATCAGGGCTCCAGCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail