Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6109
Gene name
Locationscaffold_52:13843..15385
Strand+
Gene length (bp)1542
Transcript length (bp)1542
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 4.7E-10 46 238
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.9E-08 43 237
PF00743 FMO-like Flavin-binding monooxygenase-like 3.0E-06 156 356
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 3.3E-07 124 237
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.2E-05 46 90

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 38 241 2.0E-20
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 38 241 2.0E-20
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 38 241 2.0E-20
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 27 242 4.0E-17
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 41 463 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 38 241 2.0E-20
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 38 241 2.0E-20
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 38 241 2.0E-20
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 27 242 4.0E-17
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 41 463 1.0E-16
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 41 444 1.0E-16
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 6 241 8.0E-15
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 43 403 5.0E-14
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 43 392 7.0E-14
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 43 242 1.0E-13
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 46 241 2.0E-12
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 43 241 3.0E-12
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 44 369 2.0E-11
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 36 241 2.0E-11
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 41 392 3.0E-11
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 42 368 3.0E-11
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 44 355 2.0E-10
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 44 355 2.0E-10
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 44 355 2.0E-10
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 46 366 9.0E-10
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 46 368 2.0E-09
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 46 356 3.0E-09
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 43 242 7.0E-09
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 36 241 2.0E-08
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 34 356 4.0E-08
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 34 235 9.0E-08
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 34 243 9.0E-08
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 29 241 3.0E-07
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 34 235 4.0E-07
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 43 218 5.0E-07
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 46 356 6.0E-07
sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 39 235 7.0E-07
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 34 237 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0050661 NADP binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0004497 monooxygenase activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 446 468 22
2 475 492 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6109
MPLKSQPALDNPFTLLYQLLQWLVGKALSPRPPPANGTAQRPRIAVIGAGITGVTAASHICGHGFDAVIFEAGPE
EHVGGIWSRVNDTSGLQIHSLMYRFHPSVSWQQGYPDRGQIVAEVRRLWARYGLRDKTRFNVRVESVYRDGGSWI
VNDPENGRFDGVVVAVGTCGDVKMPPLAGADKFVGPVLHSSELSARAIDVTNKQVAIVGGGASAVEALEFAIAHK
AARVTVLSRSEKWIIPRDVIVDALLSFNILGRETCLSWIPEWILRRFFYGPELEELSPPSDKGFFTDTPMVNSDI
MTRLRDGRARWLRGDIEMLTEHAVVVNRRARGVPKNGPGHHESVVADVVVMATGFRRPSLSMLPDDCFVEPYQCP
NWYLQTFPPQHPSVSAINCTFVNAVGSVGNWHIGIYTRILLMFLVDPLTRPSPVWMRRWIDMTRFLKRGSPTAAF
DFFTYLELLWWFVFCVCFNPFRWKWAVFVFLGVGLGLPRAVTRREERLLNLQGYRLRDQGSSI
Coding >Ophio5|6109
ATGCCGCTCAAGTCGCAGCCCGCCCTCGATAACCCCTTCACCTTGCTGTACCAGCTGCTTCAATGGCTGGTAGGA
AAAGCCCTCTCACCGCGGCCACCACCGGCCAACGGAACGGCTCAGCGGCCGCGCATCGCCGTCATCGGAGCCGGC
ATCACGGGCGTGACGGCGGCCTCTCACATCTGCGGCCACGGCTTCGACGCCGTCATTTTCGAGGCCGGGCCCGAG
GAACACGTGGGCGGTATCTGGAGCCGGGTCAACGACACGTCGGGCCTACAGATTCATAGCCTCATGTATCGCTTC
CACCCGTCCGTCTCTTGGCAGCAGGGCTATCCGGACCGAGGCCAGATTGTGGCCGAGGTGCGCCGGCTGTGGGCG
CGGTACGGGCTGCGAGATAAGACTCGCTTCAACGTCCGGGTCGAGAGCGTCTATCGCGATGGCGGCAGCTGGATC
GTCAATGACCCGGAGAATGGACGGTTCGATGGCGTCGTCGTCGCTGTAGGGACCTGCGGAGACGTCAAGATGCCG
CCCCTGGCCGGAGCGGACAAGTTCGTTGGGCCCGTCCTTCACTCGAGCGAGCTCTCGGCCCGAGCCATCGACGTG
ACCAACAAGCAGGTGGCCATCGTCGGGGGCGGCGCCAGCGCAGTGGAAGCGCTCGAATTCGCCATAGCGCACAAG
GCGGCGCGCGTGACGGTGCTCTCTCGATCCGAGAAATGGATCATCCCGCGAGACGTCATCGTCGACGCACTGCTG
AGCTTCAATATCCTCGGCCGAGAGACGTGTCTGTCGTGGATCCCCGAGTGGATTCTGCGTCGCTTCTTCTACGGC
CCCGAGCTCGAGGAGCTGTCGCCGCCGTCGGACAAGGGCTTCTTCACCGACACGCCCATGGTCAACTCGGACATC
ATGACCCGTCTGCGCGATGGACGTGCTCGCTGGCTGCGCGGCGACATTGAGATGCTGACGGAGCATGCCGTCGTC
GTCAATCGTCGGGCCAGGGGCGTGCCCAAGAACGGCCCCGGCCATCACGAGAGCGTCGTCGCCGACGTTGTCGTC
ATGGCTACCGGCTTCCGTCGTCCCTCGCTGTCTATGCTGCCGGACGACTGCTTTGTCGAGCCTTACCAGTGCCCC
AACTGGTATCTGCAGACGTTTCCGCCCCAGCACCCGTCCGTTTCGGCCATCAACTGCACTTTTGTCAACGCCGTC
GGCTCTGTCGGCAATTGGCACATTGGCATCTACACTCGCATCTTGCTCATGTTCCTTGTCGACCCGCTCACGCGG
CCGAGCCCGGTCTGGATGCGCCGCTGGATCGACATGACGCGCTTCCTCAAGCGCGGCAGCCCGACGGCCGCCTTT
GACTTCTTCACCTATCTCGAGCTGCTGTGGTGGTTCGTCTTTTGCGTCTGCTTCAACCCCTTTCGCTGGAAGTGG
GCAGTCTTTGTCTTCCTGGGTGTAGGCCTGGGCCTGCCCCGTGCTGTGACGAGGCGTGAGGAAAGGCTGCTGAAT
TTGCAGGGCTACCGTCTTCGGGATCAGGGCTCCAGCATC
Transcript >Ophio5|6109
ATGCCGCTCAAGTCGCAGCCCGCCCTCGATAACCCCTTCACCTTGCTGTACCAGCTGCTTCAATGGCTGGTAGGA
AAAGCCCTCTCACCGCGGCCACCACCGGCCAACGGAACGGCTCAGCGGCCGCGCATCGCCGTCATCGGAGCCGGC
ATCACGGGCGTGACGGCGGCCTCTCACATCTGCGGCCACGGCTTCGACGCCGTCATTTTCGAGGCCGGGCCCGAG
GAACACGTGGGCGGTATCTGGAGCCGGGTCAACGACACGTCGGGCCTACAGATTCATAGCCTCATGTATCGCTTC
CACCCGTCCGTCTCTTGGCAGCAGGGCTATCCGGACCGAGGCCAGATTGTGGCCGAGGTGCGCCGGCTGTGGGCG
CGGTACGGGCTGCGAGATAAGACTCGCTTCAACGTCCGGGTCGAGAGCGTCTATCGCGATGGCGGCAGCTGGATC
GTCAATGACCCGGAGAATGGACGGTTCGATGGCGTCGTCGTCGCTGTAGGGACCTGCGGAGACGTCAAGATGCCG
CCCCTGGCCGGAGCGGACAAGTTCGTTGGGCCCGTCCTTCACTCGAGCGAGCTCTCGGCCCGAGCCATCGACGTG
ACCAACAAGCAGGTGGCCATCGTCGGGGGCGGCGCCAGCGCAGTGGAAGCGCTCGAATTCGCCATAGCGCACAAG
GCGGCGCGCGTGACGGTGCTCTCTCGATCCGAGAAATGGATCATCCCGCGAGACGTCATCGTCGACGCACTGCTG
AGCTTCAATATCCTCGGCCGAGAGACGTGTCTGTCGTGGATCCCCGAGTGGATTCTGCGTCGCTTCTTCTACGGC
CCCGAGCTCGAGGAGCTGTCGCCGCCGTCGGACAAGGGCTTCTTCACCGACACGCCCATGGTCAACTCGGACATC
ATGACCCGTCTGCGCGATGGACGTGCTCGCTGGCTGCGCGGCGACATTGAGATGCTGACGGAGCATGCCGTCGTC
GTCAATCGTCGGGCCAGGGGCGTGCCCAAGAACGGCCCCGGCCATCACGAGAGCGTCGTCGCCGACGTTGTCGTC
ATGGCTACCGGCTTCCGTCGTCCCTCGCTGTCTATGCTGCCGGACGACTGCTTTGTCGAGCCTTACCAGTGCCCC
AACTGGTATCTGCAGACGTTTCCGCCCCAGCACCCGTCCGTTTCGGCCATCAACTGCACTTTTGTCAACGCCGTC
GGCTCTGTCGGCAATTGGCACATTGGCATCTACACTCGCATCTTGCTCATGTTCCTTGTCGACCCGCTCACGCGG
CCGAGCCCGGTCTGGATGCGCCGCTGGATCGACATGACGCGCTTCCTCAAGCGCGGCAGCCCGACGGCCGCCTTT
GACTTCTTCACCTATCTCGAGCTGCTGTGGTGGTTCGTCTTTTGCGTCTGCTTCAACCCCTTTCGCTGGAAGTGG
GCAGTCTTTGTCTTCCTGGGTGTAGGCCTGGGCCTGCCCCGTGCTGTGACGAGGCGTGAGGAAAGGCTGCTGAAT
TTGCAGGGCTACCGTCTTCGGGATCAGGGCTCCAGCATCTGA
Gene >Ophio5|6109
ATGCCGCTCAAGTCGCAGCCCGCCCTCGATAACCCCTTCACCTTGCTGTACCAGCTGCTTCAATGGCTGGTAGGA
AAAGCCCTCTCACCGCGGCCACCACCGGCCAACGGAACGGCTCAGCGGCCGCGCATCGCCGTCATCGGAGCCGGC
ATCACGGGCGTGACGGCGGCCTCTCACATCTGCGGCCACGGCTTCGACGCCGTCATTTTCGAGGCCGGGCCCGAG
GAACACGTGGGCGGTATCTGGAGCCGGGTCAACGACACGTCGGGCCTACAGATTCATAGCCTCATGTATCGCTTC
CACCCGTCCGTCTCTTGGCAGCAGGGCTATCCGGACCGAGGCCAGATTGTGGCCGAGGTGCGCCGGCTGTGGGCG
CGGTACGGGCTGCGAGATAAGACTCGCTTCAACGTCCGGGTCGAGAGCGTCTATCGCGATGGCGGCAGCTGGATC
GTCAATGACCCGGAGAATGGACGGTTCGATGGCGTCGTCGTCGCTGTAGGGACCTGCGGAGACGTCAAGATGCCG
CCCCTGGCCGGAGCGGACAAGTTCGTTGGGCCCGTCCTTCACTCGAGCGAGCTCTCGGCCCGAGCCATCGACGTG
ACCAACAAGCAGGTGGCCATCGTCGGGGGCGGCGCCAGCGCAGTGGAAGCGCTCGAATTCGCCATAGCGCACAAG
GCGGCGCGCGTGACGGTGCTCTCTCGATCCGAGAAATGGATCATCCCGCGAGACGTCATCGTCGACGCACTGCTG
AGCTTCAATATCCTCGGCCGAGAGACGTGTCTGTCGTGGATCCCCGAGTGGATTCTGCGTCGCTTCTTCTACGGC
CCCGAGCTCGAGGAGCTGTCGCCGCCGTCGGACAAGGGCTTCTTCACCGACACGCCCATGGTCAACTCGGACATC
ATGACCCGTCTGCGCGATGGACGTGCTCGCTGGCTGCGCGGCGACATTGAGATGCTGACGGAGCATGCCGTCGTC
GTCAATCGTCGGGCCAGGGGCGTGCCCAAGAACGGCCCCGGCCATCACGAGAGCGTCGTCGCCGACGTTGTCGTC
ATGGCTACCGGCTTCCGTCGTCCCTCGCTGTCTATGCTGCCGGACGACTGCTTTGTCGAGCCTTACCAGTGCCCC
AACTGGTATCTGCAGACGTTTCCGCCCCAGCACCCGTCCGTTTCGGCCATCAACTGCACTTTTGTCAACGCCGTC
GGCTCTGTCGGCAATTGGCACATTGGCATCTACACTCGCATCTTGCTCATGTTCCTTGTCGACCCGCTCACGCGG
CCGAGCCCGGTCTGGATGCGCCGCTGGATCGACATGACGCGCTTCCTCAAGCGCGGCAGCCCGACGGCCGCCTTT
GACTTCTTCACCTATCTCGAGCTGCTGTGGTGGTTCGTCTTTTGCGTCTGCTTCAACCCCTTTCGCTGGAAGTGG
GCAGTCTTTGTCTTCCTGGGTGTAGGCCTGGGCCTGCCCCGTGCTGTGACGAGGCGTGAGGAAAGGCTGCTGAAT
TTGCAGGGCTACCGTCTTCGGGATCAGGGCTCCAGCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail