Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6108
Gene name
Locationscaffold_52:12896..13500
Strand-
Gene length (bp)604
Transcript length (bp)495
Coding sequence length (bp)492
Protein length (aa) 164

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Plastid 0.3969 0.3643 0.1129 0.0823 0.3245 0.665 0.4119 0.4264 0.0958 0.2176

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3436
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|426
Ophiocordyceps australis map64 (Brazil) OphauB2|219
Ophiocordyceps camponoti-floridani Ophcf2|04960
Ophiocordyceps camponoti-rufipedis Ophun1|5589
Ophiocordyceps kimflemingae Ophio5|6108 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6532

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6108
MEHPVQDIGSVIASLATGSPTEQQATLQTYFLSDASFSHPLCRVPSFPKGTVPFAPAVDSRAVILQIYRWYRTLS
PHIDISVDSAVFDKRTGRLFVEIHQTFAIWFLPLYRARLRLITLLHLRPCNSPDSAEDGRSAATGRERSRYFIAN
QEDLASDVVRVAAV
Coding >Ophio5|6108
ATGGAGCATCCCGTTCAGGACATCGGCAGCGTCATCGCCTCTCTCGCCACCGGCAGCCCCACGGAGCAGCAAGCC
ACGCTGCAGACCTATTTCCTGTCCGATGCCTCTTTCTCGCACCCGCTTTGCCGTGTACCGTCCTTTCCCAAGGGC
ACCGTGCCTTTCGCTCCAGCCGTCGACTCGCGAGCTGTCATCCTCCAGATCTACCGCTGGTATCGCACGCTGAGC
CCGCACATTGACATTTCCGTCGATTCCGCCGTCTTTGATAAGCGTACCGGCCGGCTCTTCGTCGAAATTCACCAG
ACTTTCGCCATATGGTTTCTGCCCCTGTATCGAGCTCGCCTCCGGCTCATCACCTTGCTGCATCTGCGCCCATGC
AACTCGCCCGACTCGGCCGAAGATGGCCGGTCCGCCGCCACCGGCCGGGAGCGCAGCCGTTACTTCATCGCCAAT
CAGGAGGATCTGGCCTCTGATGTGGTACGCGTGGCAGCTGTT
Transcript >Ophio5|6108
ATGGAGCATCCCGTTCAGGACATCGGCAGCGTCATCGCCTCTCTCGCCACCGGCAGCCCCACGGAGCAGCAAGCC
ACGCTGCAGACCTATTTCCTGTCCGATGCCTCTTTCTCGCACCCGCTTTGCCGTGTACCGTCCTTTCCCAAGGGC
ACCGTGCCTTTCGCTCCAGCCGTCGACTCGCGAGCTGTCATCCTCCAGATCTACCGCTGGTATCGCACGCTGAGC
CCGCACATTGACATTTCCGTCGATTCCGCCGTCTTTGATAAGCGTACCGGCCGGCTCTTCGTCGAAATTCACCAG
ACTTTCGCCATATGGTTTCTGCCCCTGTATCGAGCTCGCCTCCGGCTCATCACCTTGCTGCATCTGCGCCCATGC
AACTCGCCCGACTCGGCCGAAGATGGCCGGTCCGCCGCCACCGGCCGGGAGCGCAGCCGTTACTTCATCGCCAAT
CAGGAGGATCTGGCCTCTGATGTGGTACGCGTGGCAGCTGTTTAG
Gene >Ophio5|6108
ATGGAGCATCCCGTTCAGGACATCGGCAGCGTCATCGCCTCTCTCGCCACCGGCAGCCCCACGGAGCAGCAAGCC
ACGCTGCAGACCTATTTCCTGTCCGATGCCTCTTTCTCGCACCCGCTTTGCCGTGTACCGTCCTTTCCCAAGGGC
ACCGTGCCTTTCGCTCCAGCCGTCGACTCGCGAGCTGTCATCCTCCAGATCTACCGCTGGTATCGCACGCTGAGC
CCGCACATTGACATTTCCGTCGATTCCGCCGGTCTGTACTCTCCTCTCCATTCCGTTCTTCTCGAGACGATGCCA
TAGCTCATATGCCCACTTCAGTCTTTGATAAGCGTACCGGCCGGCTCTTCGTCGAAATTCACCAGACTTTCGCCA
TATGGTTTCTGCCCCTGTATCGAGCTCGCCTCCGGCTCATCACCTTGCTGCATCTGCGCCCATGCAACTCGCCCG
ACTCGGCCGAAGATGGCCGGTCCGCCGCCACCGGCCGGGAGCGCAGCCGTTACTTCATCGCCAATCAGGAGGATC
TGTACACCATCAACGACTGCGCTCAGTTCTTGCTGCCTGGCTTAGGGCCTCTGATGTGGTACGCGTGGCAGCTGT
TTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail