Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6094
Gene name
Locationscaffold_518:10629..13548
Strand+
Gene length (bp)2919
Transcript length (bp)2592
Coding sequence length (bp)2589
Protein length (aa) 863

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00170 bZIP_1 bZIP transcription factor 6.8E-11 508 569
PF03131 bZIP_Maf bZIP Maf transcription factor 3.4E-07 504 570
PF07716 bZIP_2 Basic region leucine zipper 3.2E-05 509 560

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0003677 DNA binding Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0003676 nucleic acid binding No
GO:0010468 regulation of gene expression No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 108 130 22
2 143 160 17

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 18.58 9.61 27.55
CcL In ants, during behavior modification 7.68 3.17 12.20
CcD In ants, recently dead 7.00 2.85 11.15

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000535 yes
SC16a CcD 0.000286 yes
CcL CcD 0.793304 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6094
MPPARCDDATLCTLRYSSSGILGGGYLASQSIIVRTVSARTRNLPRPGAIGFDLDRSISLLVLVSAVSLSLSLHS
PNPSLFDTGTASSHGPFSPPPPFFSFPLPTSSASPVTFSSLLLILLLLLLLLLLLRHCSRLRLPRLDFSSFYASY
LLFTLARISRLPPRHLVCRYSNWPRFTSHRLTFSPTQAPSHASQPSARVTACPRDSPVRRCIRTSRFTPTPPLLP
SSTPATSRTAAALSSLWHPAVAHLHLAMVLQYAAQPFYRAANLTVDTSHAQQKYTEDEDKSVLDDGILDPGAVDS
GLELSPPMVSSRRESFAVGSALFSPKSEGWHSVDMQSLPSNNPFVDAQGSTSSSNPFARLDHNQQQVFGQHQAGG
WLVGHGHGSGSGSGSGAATPFPTFDHVPTTEYDSGVSIFQRQMQNQTPFGGAGNNIFGPIGHGDQSMPTSPQKEW
MAANKKMRPGSPVIRSHNDMRRGDGIRKKNARFEIPAERNLSNIDQLISQSTDDQEIKELKQQKRLLRNRQAALD
SRQRKKQHTERLEDEKKQFTALVTDMEEEISSLKAKMDQLLREKQSYSDYIETLTLEKDEMIRAHTLETGVLRKK
LGVITDHVQRLESNAMTQASHSFGDDYDGMGDIAMAGGWDNAGFLNVNDYAVEAPPVKQHMAVVKKNEAPTPEGD
KGAVSQGGLLFMLFLVGAFVMSSRSTPAIPQVSEDVRAASATLLDNVLKDAGVSSQSHGLQPSGSSWPQPAPSMG
VAPSMLEELGDSLTQPTEEQTNEQIFSLTAAEYSNHQDYGGPSPTRPPSHGRKNLADALASMRAANKQTGAAEVY
TRSLLWDQIPSEVVRNFAKMVAECSNAQNEQPCHETTT
Coding >Ophio5|6094
ATGCCGCCCGCCCGTTGCGACGACGCGACACTGTGTACGCTCAGGTACTCTTCGTCAGGGATCCTTGGTGGTGGC
TACCTGGCGTCACAGTCCATCATTGTACGCACTGTCTCGGCCCGTACCCGCAACCTTCCCCGGCCTGGAGCTATC
GGCTTCGACCTCGATCGCTCCATCAGCCTCTTAGTACTAGTATCTGCTGTTTCTCTCTCTCTCTCTCTTCATAGC
CCGAATCCCTCGTTGTTCGACACTGGGACCGCGTCTTCCCACGGCCCTTTTTCACCCCCCCCCCCATTCTTTTCT
TTTCCTCTTCCAACCTCCTCCGCGTCGCCGGTCACTTTCTCTTCCCTTCTCCTCATTCTCCTCCTCCTCCTCCTC
CTCCTCCTCCTCCTCCGCCACTGTTCTCGCCTTCGCCTCCCCCGCCTCGACTTCTCCTCATTCTACGCTTCTTAC
TTACTCTTCACCCTTGCCCGCATCTCCCGCCTCCCGCCTCGCCATCTCGTCTGCAGATACAGTAATTGGCCTCGA
TTCACATCACATCGCCTCACTTTTTCCCCCACACAAGCCCCATCACACGCCTCTCAGCCCTCAGCCCGTGTCACA
GCCTGCCCGCGAGACTCTCCTGTGAGACGGTGCATTCGAACAAGCCGCTTCACTCCTACCCCCCCCCTTCTGCCC
TCTTCCACACCCGCCACATCCCGGACTGCGGCCGCTCTTTCGTCTCTTTGGCACCCTGCGGTAGCCCATCTTCAT
CTTGCCATGGTCTTGCAGTATGCGGCGCAGCCTTTTTACCGCGCTGCCAATCTGACGGTGGATACGAGCCATGCT
CAGCAAAAATACACGGAAGACGAGGACAAGAGCGTGCTCGACGACGGCATTCTTGACCCCGGCGCCGTAGACTCT
GGCCTCGAGCTGTCGCCTCCCATGGTCAGCAGCCGCCGCGAATCCTTTGCCGTCGGCAGCGCCCTGTTCTCACCA
AAATCCGAGGGCTGGCACTCTGTTGACATGCAGTCGCTGCCTTCCAACAACCCCTTCGTCGATGCTCAGGGCAGC
ACCAGCAGCAGTAATCCTTTTGCCCGTCTCGATCACAACCAGCAGCAAGTCTTTGGACAGCATCAGGCCGGCGGT
TGGCTGGTGGGTCACGGCCACGGCTCCGGTTCCGGTTCCGGCTCCGGCGCCGCGACGCCCTTCCCCACATTCGAT
CACGTCCCCACCACCGAGTACGACTCTGGCGTCTCCATCTTCCAACGGCAGATGCAGAACCAAACGCCGTTTGGA
GGCGCCGGCAACAACATCTTTGGTCCCATCGGCCACGGTGACCAGTCGATGCCGACATCTCCCCAAAAGGAGTGG
ATGGCCGCCAACAAGAAGATGCGGCCCGGCAGCCCCGTCATTCGGTCTCACAACGACATGAGGCGCGGTGACGGA
ATCCGCAAGAAAAACGCCCGCTTCGAGATCCCGGCTGAGCGCAACCTCAGCAACATCGACCAGTTGATATCTCAG
TCCACCGACGATCAGGAGATTAAGGAACTCAAGCAGCAGAAGCGTCTGCTGCGGAATCGACAGGCGGCCCTCGAC
TCGCGGCAGAGAAAAAAGCAGCACACGGAGCGGCTCGAAGACGAAAAGAAGCAGTTTACGGCGCTCGTGACGGAC
ATGGAGGAGGAGATCAGCTCACTCAAGGCCAAGATGGATCAGCTGCTCCGGGAAAAGCAGTCGTATAGCGACTAC
ATCGAGACGCTCACACTGGAAAAGGACGAGATGATCCGCGCGCACACGCTCGAGACGGGCGTTTTGCGCAAAAAG
TTGGGCGTCATCACCGACCACGTCCAGCGACTGGAAAGCAACGCCATGACACAGGCCAGCCACAGCTTCGGCGAC
GACTACGACGGCATGGGCGACATTGCCATGGCCGGCGGCTGGGACAACGCCGGCTTCCTCAACGTCAACGACTAT
GCCGTCGAGGCGCCGCCGGTCAAGCAGCACATGGCGGTCGTCAAGAAGAACGAGGCACCGACGCCCGAGGGAGAC
AAGGGCGCCGTCTCTCAGGGCGGACTGCTGTTCATGCTGTTCCTCGTCGGCGCCTTCGTCATGTCCAGCCGATCG
ACGCCGGCGATCCCGCAGGTATCGGAAGACGTCCGGGCCGCGTCGGCGACGCTGCTGGACAACGTACTCAAGGAC
GCCGGTGTCAGCTCGCAGTCCCACGGCCTACAGCCTTCGGGGTCCAGCTGGCCGCAGCCGGCGCCGAGCATGGGC
GTGGCGCCCTCGATGCTCGAGGAGCTGGGCGACTCTCTGACGCAGCCGACGGAAGAGCAGACCAACGAGCAGATC
TTCTCCCTGACGGCGGCCGAGTACAGCAACCACCAGGACTACGGCGGGCCGTCACCGACGCGACCGCCGAGCCAC
GGGCGAAAGAACCTGGCAGACGCGCTGGCCTCGATGCGGGCGGCCAACAAGCAGACGGGCGCGGCCGAGGTCTAC
ACGCGTTCCCTGCTCTGGGACCAGATTCCGAGCGAGGTGGTGCGCAACTTTGCCAAGATGGTTGCCGAGTGCAGC
AATGCGCAGAACGAGCAGCCCTGTCATGAGACGACGACA
Transcript >Ophio5|6094
ATGCCGCCCGCCCGTTGCGACGACGCGACACTGTGTACGCTCAGGTACTCTTCGTCAGGGATCCTTGGTGGTGGC
TACCTGGCGTCACAGTCCATCATTGTACGCACTGTCTCGGCCCGTACCCGCAACCTTCCCCGGCCTGGAGCTATC
GGCTTCGACCTCGATCGCTCCATCAGCCTCTTAGTACTAGTATCTGCTGTTTCTCTCTCTCTCTCTCTTCATAGC
CCGAATCCCTCGTTGTTCGACACTGGGACCGCGTCTTCCCACGGCCCTTTTTCACCCCCCCCCCCATTCTTTTCT
TTTCCTCTTCCAACCTCCTCCGCGTCGCCGGTCACTTTCTCTTCCCTTCTCCTCATTCTCCTCCTCCTCCTCCTC
CTCCTCCTCCTCCTCCGCCACTGTTCTCGCCTTCGCCTCCCCCGCCTCGACTTCTCCTCATTCTACGCTTCTTAC
TTACTCTTCACCCTTGCCCGCATCTCCCGCCTCCCGCCTCGCCATCTCGTCTGCAGATACAGTAATTGGCCTCGA
TTCACATCACATCGCCTCACTTTTTCCCCCACACAAGCCCCATCACACGCCTCTCAGCCCTCAGCCCGTGTCACA
GCCTGCCCGCGAGACTCTCCTGTGAGACGGTGCATTCGAACAAGCCGCTTCACTCCTACCCCCCCCCTTCTGCCC
TCTTCCACACCCGCCACATCCCGGACTGCGGCCGCTCTTTCGTCTCTTTGGCACCCTGCGGTAGCCCATCTTCAT
CTTGCCATGGTCTTGCAGTATGCGGCGCAGCCTTTTTACCGCGCTGCCAATCTGACGGTGGATACGAGCCATGCT
CAGCAAAAATACACGGAAGACGAGGACAAGAGCGTGCTCGACGACGGCATTCTTGACCCCGGCGCCGTAGACTCT
GGCCTCGAGCTGTCGCCTCCCATGGTCAGCAGCCGCCGCGAATCCTTTGCCGTCGGCAGCGCCCTGTTCTCACCA
AAATCCGAGGGCTGGCACTCTGTTGACATGCAGTCGCTGCCTTCCAACAACCCCTTCGTCGATGCTCAGGGCAGC
ACCAGCAGCAGTAATCCTTTTGCCCGTCTCGATCACAACCAGCAGCAAGTCTTTGGACAGCATCAGGCCGGCGGT
TGGCTGGTGGGTCACGGCCACGGCTCCGGTTCCGGTTCCGGCTCCGGCGCCGCGACGCCCTTCCCCACATTCGAT
CACGTCCCCACCACCGAGTACGACTCTGGCGTCTCCATCTTCCAACGGCAGATGCAGAACCAAACGCCGTTTGGA
GGCGCCGGCAACAACATCTTTGGTCCCATCGGCCACGGTGACCAGTCGATGCCGACATCTCCCCAAAAGGAGTGG
ATGGCCGCCAACAAGAAGATGCGGCCCGGCAGCCCCGTCATTCGGTCTCACAACGACATGAGGCGCGGTGACGGA
ATCCGCAAGAAAAACGCCCGCTTCGAGATCCCGGCTGAGCGCAACCTCAGCAACATCGACCAGTTGATATCTCAG
TCCACCGACGATCAGGAGATTAAGGAACTCAAGCAGCAGAAGCGTCTGCTGCGGAATCGACAGGCGGCCCTCGAC
TCGCGGCAGAGAAAAAAGCAGCACACGGAGCGGCTCGAAGACGAAAAGAAGCAGTTTACGGCGCTCGTGACGGAC
ATGGAGGAGGAGATCAGCTCACTCAAGGCCAAGATGGATCAGCTGCTCCGGGAAAAGCAGTCGTATAGCGACTAC
ATCGAGACGCTCACACTGGAAAAGGACGAGATGATCCGCGCGCACACGCTCGAGACGGGCGTTTTGCGCAAAAAG
TTGGGCGTCATCACCGACCACGTCCAGCGACTGGAAAGCAACGCCATGACACAGGCCAGCCACAGCTTCGGCGAC
GACTACGACGGCATGGGCGACATTGCCATGGCCGGCGGCTGGGACAACGCCGGCTTCCTCAACGTCAACGACTAT
GCCGTCGAGGCGCCGCCGGTCAAGCAGCACATGGCGGTCGTCAAGAAGAACGAGGCACCGACGCCCGAGGGAGAC
AAGGGCGCCGTCTCTCAGGGCGGACTGCTGTTCATGCTGTTCCTCGTCGGCGCCTTCGTCATGTCCAGCCGATCG
ACGCCGGCGATCCCGCAGGTATCGGAAGACGTCCGGGCCGCGTCGGCGACGCTGCTGGACAACGTACTCAAGGAC
GCCGGTGTCAGCTCGCAGTCCCACGGCCTACAGCCTTCGGGGTCCAGCTGGCCGCAGCCGGCGCCGAGCATGGGC
GTGGCGCCCTCGATGCTCGAGGAGCTGGGCGACTCTCTGACGCAGCCGACGGAAGAGCAGACCAACGAGCAGATC
TTCTCCCTGACGGCGGCCGAGTACAGCAACCACCAGGACTACGGCGGGCCGTCACCGACGCGACCGCCGAGCCAC
GGGCGAAAGAACCTGGCAGACGCGCTGGCCTCGATGCGGGCGGCCAACAAGCAGACGGGCGCGGCCGAGGTCTAC
ACGCGTTCCCTGCTCTGGGACCAGATTCCGAGCGAGGTGGTGCGCAACTTTGCCAAGATGGTTGCCGAGTGCAGC
AATGCGCAGAACGAGCAGCCCTGTCATGAGACGACGACATGA
Gene >Ophio5|6094
ATGCCGCCCGCCCGTTGCGACGACGCGACACTGTGTACGCTCAGGTACTCTTCGTCAGGGATCCTTGGTGGTGGC
TACCTGGCGTCACAGTCCATCATTGTACGCACTGTCTCGGCCCGTACCCGCAACCTTCCCCGGCCTGGAGCTATC
GGCTTCGACCTCGATCGCTCCATCAGCCTCTTAGTACTAGTATCTGCTGTTTCTCTCTCTCTCTCTCTTCATAGC
CCGAATCCCTCGTTGTTCGACACTGGGACCGCGTCTTCCCACGGCCCTTTTTCACCCCCCCCCCCATTCTTTTCT
TTTCCTCTTCCAACCTCCTCCGCGTCGCCGGTCACTTTCTCTTCCCTTCTCCTCATTCTCCTCCTCCTCCTCCTC
CTCCTCCTCCTCCTCCGCCACTGTTCTCGCCTTCGCCTCCCCCGCCTCGACTTCTCCTCATTCTACGCTTCTTAC
TTACTCTTCACCCTTGCCCGCATCTCCCGCCTCCCGCCTCGCCATCTCGTCTGCAGATACAGTAATTGGCCTCGA
TTCACATCACATCGCCTCACTTTTTCCCCCACACAAGCCCCATCACACGCCTCTCAGCCCTCAGCCCGTGTCACA
GCCTGCCCGCGAGACTCTCCTGTGAGACGGTGCATTCGAACAAGGTGAGCAGAACTCTCCTCGTGTCGCCTCCCC
CTCTTCTTTCCCCTATCCCGCCCTCGTGTCTCTTGCTCCAGATTGTTCGACAAGCGGCCAAATGCATGCATGGTG
CCATGTTTCACTCCCTCTCAGCAACCTTCATCTTCTCCGACTCCTTGTTTTGTCTCCGTCTTGGCCATGCACCTA
GACAGATGTCGTCCATCCCCTTAGACCAAAGACACTCAGACCCTTGAGATCCGTCCCCTACGATTAAGACACTCA
CACTCGTCAGCCCAGCCGCTTCACTCCTACCCCCCCCCTTCTGCCCTCTTCCACACCCGCCACATCCCGGACTGC
GGCCGCTCTTTCGTCTCTTTGGCACCCTGCGGTAGCCCATCTTCATCTTGCCATGGTCTTGCAGTATGCGGCGCA
GCCTTTTTACCGCGCTGCCAATCTGACGGTGGATACGAGCCATGCTCAGCAAAAATACACGGAAGACGAGGACAA
GAGCGTGCTCGACGACGGCATTCTTGACCCCGGCGCCGTAGACTCTGGCCTCGAGCTGTCGCCTCCCATGGTCAG
CAGCCGCCGCGAATCCTTTGCCGTCGGCAGCGCCCTGTTCTCACCAAAATCCGAGGGCTGGCACTCTGTTGACAT
GCAGTCGCTGCCTTCCAACAACCCCTTCGTCGATGCTCAGGGCAGCACCAGCAGCAGTAATCCTTTTGCCCGTCT
CGATCACAACCAGCAGCAAGTCTTTGGACAGCATCAGGCCGGCGGTTGGCTGGTGGGTCACGGCCACGGCTCCGG
TTCCGGTTCCGGCTCCGGCGCCGCGACGCCCTTCCCCACATTCGATCACGTCCCCACCACCGAGTACGACTCTGG
CGTCTCCATCTTCCAACGGCAGATGCAGAACCAAACGCCGTTTGGAGGCGCCGGCAACAACATCTTTGGTCCCAT
CGGCCACGGTGACCAGTCGATGCCGACATCTCCCCAAAAGGAGTGGATGGCCGCCAACAAGAAGATGCGGCCCGG
CAGCCCCGTCATTCGGTCTCACAACGACATGAGGCGCGGTGACGGAATCCGCAAGAAAAACGCCCGCTTCGAGAT
CCCGGCTGAGCGCAACCTCAGCAACATCGACCAGTTGATATCTCAGTCCACCGACGATCAGGAGATTAAGGAACT
CAAGCAGCAGAAGCGTCTGCTGCGGAATCGACAGGCGGCGTGAGTGCTTCCTGAGAGCCATTTTGGTGAAGACGA
TGCTGACTGCCTCCCTTCAGCCTCGACTCGCGGCAGAGAAAAAAGCAGCACACGGAGCGGCTCGAAGACGAAAAG
AAGCAGTTTACGGCGCTCGTGACGGACATGGAGGAGGAGATCAGCTCACTCAAGGCCAAGATGGATCAGCTGCTC
CGGGAAAAGCAGTCGTATAGCGACTACATCGAGACGCTCACACTGGAAAAGGACGAGATGATCCGCGCGCACACG
CTCGAGACGGGCGTTTTGCGCAAAAAGTTGGGCGTCATCACCGACCACGTCCAGCGACTGGAAAGCAACGCCATG
ACACAGGCCAGCCACAGCTTCGGCGACGACTACGACGGCATGGGCGACATTGCCATGGCCGGCGGCTGGGACAAC
GCCGGCTTCCTCAACGTCAACGACTATGCCGTCGAGGCGCCGCCGGTCAAGCAGCACATGGCGGTCGTCAAGAAG
AACGAGGCACCGACGCCCGAGGGAGACAAGGGCGCCGTCTCTCAGGGCGGACTGCTGTTCATGCTGTTCCTCGTC
GGCGCCTTCGTCATGTCCAGCCGATCGACGCCGGCGATCCCGCAGGTATCGGAAGACGTCCGGGCCGCGTCGGCG
ACGCTGCTGGACAACGTACTCAAGGACGCCGGTGTCAGCTCGCAGTCCCACGGCCTACAGCCTTCGGGGTCCAGC
TGGCCGCAGCCGGCGCCGAGCATGGGCGTGGCGCCCTCGATGCTCGAGGAGCTGGGCGACTCTCTGACGCAGCCG
ACGGAAGAGCAGACCAACGAGCAGATCTTCTCCCTGACGGCGGCCGAGTACAGCAACCACCAGGACTACGGCGGG
CCGTCACCGACGCGACCGCCGAGCCACGGGCGAAAGAACCTGGCAGACGCGCTGGCCTCGATGCGGGCGGCCAAC
AAGCAGACGGGCGCGGCCGAGGTCTACACGCGTTCCCTGCTCTGGGACCAGATTCCGAGCGAGGTGGTGCGCAAC
TTTGCCAAGATGGTTGCCGAGTGCAGCAATGCGCAGAACGAGCAGCCCTGTCATGAGACGACGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail