Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6090
Gene name
Locationscaffold_518:588..2447
Strand-
Gene length (bp)1859
Transcript length (bp)1686
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11815 DUF3336 Domain of unknown function (DUF3336) 1.2E-31 28 170
PF01734 Patatin Patatin-like phospholipase 1.9E-13 179 351

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7P3|TLG3_SCHPO Probable triacylglycerol lipase C1450.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.16c PE=3 SV=2 40 530 3.0E-89
sp|Q9LZA6|SDP1_ARATH Triacylglycerol lipase SDP1 OS=Arabidopsis thaliana GN=SDP1 PE=1 SV=1 33 541 2.0E-68
sp|P36165|TGL4_YEAST Lipase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL4 PE=1 SV=1 40 538 2.0E-67
sp|Q9M1I6|SDP1L_ARATH Triacylglycerol lipase SDP1L OS=Arabidopsis thaliana GN=SDP1L PE=1 SV=1 33 541 5.0E-67
sp|Q12043|TGL5_YEAST Lipase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL5 PE=1 SV=1 40 533 1.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7P3|TLG3_SCHPO Probable triacylglycerol lipase C1450.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.16c PE=3 SV=2 40 530 3.0E-89
sp|Q9LZA6|SDP1_ARATH Triacylglycerol lipase SDP1 OS=Arabidopsis thaliana GN=SDP1 PE=1 SV=1 33 541 2.0E-68
sp|P36165|TGL4_YEAST Lipase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL4 PE=1 SV=1 40 538 2.0E-67
sp|Q9M1I6|SDP1L_ARATH Triacylglycerol lipase SDP1L OS=Arabidopsis thaliana GN=SDP1L PE=1 SV=1 33 541 5.0E-67
sp|Q12043|TGL5_YEAST Lipase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL5 PE=1 SV=1 40 533 1.0E-62
sp|Q9Y827|YEX5_SCHPO Uncharacterized protein C1A6.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.05c PE=4 SV=1 29 534 1.0E-61
sp|Q6C8W4|PLPL_YARLI Patatin-like phospholipase domain-containing protein YALI0D16379g OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D16379g PE=3 SV=1 37 541 2.0E-50
sp|A5DIR3|PLPL_PICGU Patatin-like phospholipase domain-containing protein PGUG_03164 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_03164 PE=3 SV=2 39 561 2.0E-50
sp|Q5AM72|PLPL_CANAL Patatin-like phospholipase domain-containing protein CaO19.1504 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.1504 PE=3 SV=1 1 543 4.0E-49
sp|P0CP53|PLPL_CRYNB Patatin-like phospholipase domain-containing protein CNBE2340 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBE2340 PE=3 SV=1 39 544 4.0E-49
sp|P0CP52|PLPL_CRYNJ Patatin-like phospholipase domain-containing protein CNE02340 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNE02340 PE=3 SV=1 39 544 4.0E-49
sp|O14115|PLPL_SCHPO Patatin-like phospholipase domain-containing protein SPAC1786.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1786.01c PE=3 SV=2 37 555 2.0E-48
sp|Q0CUP0|PLPL_ASPTN Patatin-like phospholipase domain-containing protein ATEG_02594 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_02594 PE=3 SV=1 3 535 1.0E-47
sp|Q6BXC8|PLPL_DEBHA Patatin-like phospholipase domain-containing protein DEHA2B04136g OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2B04136g PE=3 SV=2 39 538 2.0E-47
sp|A5DUA8|PLPL_LODEL Patatin-like phospholipase domain-containing protein LELG_00944 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_00944 PE=3 SV=1 22 547 7.0E-47
sp|A2Q8F7|PLPL_ASPNC Patatin-like phospholipase domain-containing protein An01g04180 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g04180 PE=3 SV=1 4 535 9.0E-47
sp|Q2UKE6|PLPL_ASPOR Patatin-like phospholipase domain-containing protein AO090003000839 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090003000839 PE=3 SV=1 33 553 4.0E-46
sp|P40308|TGL3_YEAST Lipase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL3 PE=1 SV=2 4 421 5.0E-46
sp|Q4WJS4|PLPL_ASPFU Patatin-like phospholipase domain-containing protein AFUA_1G04970 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G04970 PE=3 SV=1 17 527 2.0E-45
sp|A1D4C8|PLPL_NEOFI Patatin-like phospholipase domain-containing protein NFIA_019760 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_019760 PE=3 SV=1 17 527 2.0E-45
sp|Q5BGC2|PLPL_EMENI Patatin-like phospholipase domain-containing protein AN0408 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0408 PE=3 SV=1 24 530 3.0E-45
sp|P0CT18|PLPL_MAGOY Patatin-like phospholipase domain-containing protein OOU_Y34scaffold00095g16.3 OS=Magnaporthe oryzae (strain Y34) GN=OOU_Y34scaffold00095g16.3 PE=3 SV=1 5 538 3.0E-44
sp|A4R8V2|PLPL_MAGO7 Patatin-like phospholipase domain-containing protein MGG_12849 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_12849 PE=3 SV=1 5 538 3.0E-44
sp|A1CRG6|PLPL_ASPCL Patatin-like phospholipase domain-containing protein ACLA_029670 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_029670 PE=3 SV=1 4 527 9.0E-43
sp|Q1DXR6|PLPL_COCIM Patatin-like phospholipase domain-containing protein CIMG_04897 OS=Coccidioides immitis (strain RS) GN=CIMG_04897 PE=3 SV=1 1 527 1.0E-40
sp|Q2HA54|PLPL_CHAGB Patatin-like phospholipase domain-containing protein CHGG_02900 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_02900 PE=3 SV=1 3 527 6.0E-40
sp|P0C584|PLPL_NEUCR Patatin-like phospholipase domain-containing protein NCU11180 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00381 PE=3 SV=1 94 527 1.0E-38
sp|Q0V4Z6|PLPL_PHANO Patatin-like phospholipase domain-containing protein SNOG_00918 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_00918 PE=3 SV=2 6 538 4.0E-30
sp|P40308|TGL3_YEAST Lipase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL3 PE=1 SV=2 446 538 9.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0004806 triglyceride lipase activity Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0016298 lipase activity No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 173 195 22
2 202 224 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6090
MGAVLAIWSVFVDVVSFWRRELFNWYNRRNPVELWLELLRNAQTFEEWEEAALHLDSLLGLDLWCNNPTSREYDW
RLITDRLNSLVIAREAGNVQLLVNLLRSGLVRNLGNITMPKLYNRSLSGTKYLIDEYITQMAEAVEDISTLPMAL
TTGGPSALTNQMKLDFIHDARQAFGRSALVLQGGAIFGLCHLGVVKALFLRGLLPRIITGTATGALIAALVAIHT
EDELPRILEGDGIDLTAFTSRPGAAGRETPRQQTFRSRWDTLMRRIRRFSREGYFLDLTVLENCVRANVDDLTFE
EAYNRSKRILNITVATEGRGGVPTLLNYITAPNVLIWTAAIASNASSPSFYGRREVILCKDAGGNVVPWEPATTT
DFRHWTHASYSERDSPLRRTSELFNVNHFIVSQARPYLIPFLQSDMHGPSLVEARSRATQLSAFFARMVGLEVQH
RLRQLDTLRLLPSSIRRFLVDEQVPGAAMTLVPEVTAGDFVRLLETPTRETLQYWILRGERSVWPAVAALRIRCA
VEYELDRAYQAVRKLKAGDLRRKGSIAGTMDYNGRQ
Coding >Ophio5|6090
ATGGGAGCTGTGCTGGCTATCTGGAGTGTGTTTGTCGACGTCGTCTCCTTCTGGCGCAGAGAGCTCTTCAACTGG
TACAATCGAAGGAACCCGGTCGAGCTGTGGCTAGAACTCCTCCGCAATGCCCAGACATTCGAAGAGTGGGAGGAG
GCGGCCCTCCACCTGGACAGTCTGCTCGGGCTCGATCTATGGTGCAATAACCCGACGTCGCGAGAATACGACTGG
AGGCTCATCACGGACCGGCTCAACTCGTTGGTCATCGCGAGGGAAGCGGGCAACGTTCAGCTGCTGGTCAACCTC
CTCCGCTCCGGCCTCGTGCGAAACCTGGGCAACATCACGATGCCCAAGCTCTACAACCGATCTCTTTCCGGCACC
AAGTACCTGATCGACGAGTACATCACGCAAATGGCCGAGGCGGTCGAGGATATCAGCACGCTGCCCATGGCCTTG
ACGACGGGGGGGCCGTCGGCGCTGACGAACCAGATGAAGCTCGACTTTATCCACGACGCGAGGCAGGCTTTCGGA
CGCAGCGCGCTGGTGCTTCAGGGGGGAGCCATCTTTGGCCTGTGCCACCTCGGCGTCGTCAAGGCCCTGTTCCTG
CGGGGCCTGCTGCCGCGCATTATCACGGGCACGGCGACGGGCGCCCTCATCGCGGCGCTGGTGGCCATCCACACC
GAGGACGAGCTGCCGCGCATCCTCGAGGGCGACGGCATCGACTTGACGGCCTTTACGAGCCGGCCCGGGGCCGCC
GGTCGGGAGACGCCTCGGCAGCAGACGTTTCGCTCGAGGTGGGATACGCTGATGCGTAGGATCCGACGCTTCTCG
CGGGAAGGCTACTTTCTCGACCTGACGGTGCTCGAGAACTGCGTGCGGGCCAACGTCGACGACCTGACGTTTGAG
GAGGCATACAACCGCAGCAAGCGGATCCTCAACATAACCGTCGCGACCGAGGGCCGAGGCGGCGTGCCGACGCTG
CTCAACTACATCACGGCGCCCAACGTGTTGATCTGGACGGCGGCCATCGCATCCAACGCGTCCTCGCCGTCGTTT
TACGGGAGGCGAGAAGTGATTCTGTGCAAAGACGCGGGTGGTAACGTGGTGCCGTGGGAACCGGCGACGACGACC
GACTTCCGGCACTGGACGCACGCCTCTTACTCGGAGAGGGACTCGCCGCTGCGGCGCACATCAGAGCTCTTCAAC
GTGAACCACTTCATCGTCAGCCAGGCGCGACCGTACTTGATCCCCTTTCTCCAGTCAGACATGCACGGCCCGTCG
TTGGTGGAGGCGCGCAGCAGGGCGACGCAGTTGTCAGCCTTTTTCGCCCGCATGGTCGGGTTGGAGGTGCAGCAC
CGGCTCAGACAGTTGGACACGCTGCGGTTACTGCCGTCGAGCATCCGACGCTTCCTGGTGGACGAGCAGGTGCCC
GGGGCGGCCATGACGCTGGTGCCCGAGGTGACGGCGGGCGACTTTGTGCGTCTCCTGGAGACGCCGACGCGGGAG
ACACTGCAGTACTGGATCCTCCGGGGCGAGAGGAGCGTGTGGCCGGCGGTGGCGGCGCTGCGGATCCGCTGCGCC
GTCGAGTACGAGCTAGACCGGGCCTACCAGGCGGTGCGGAAGCTCAAGGCCGGCGACCTGCGACGTAAGGGGAGC
ATCGCGGGGACCATGGATTACAATGGCCGGCAG
Transcript >Ophio5|6090
ATGGGAGCTGTGCTGGCTATCTGGAGTGTGTTTGTCGACGTCGTCTCCTTCTGGCGCAGAGAGCTCTTCAACTGG
TACAATCGAAGGAACCCGGTCGAGCTGTGGCTAGAACTCCTCCGCAATGCCCAGACATTCGAAGAGTGGGAGGAG
GCGGCCCTCCACCTGGACAGTCTGCTCGGGCTCGATCTATGGTGCAATAACCCGACGTCGCGAGAATACGACTGG
AGGCTCATCACGGACCGGCTCAACTCGTTGGTCATCGCGAGGGAAGCGGGCAACGTTCAGCTGCTGGTCAACCTC
CTCCGCTCCGGCCTCGTGCGAAACCTGGGCAACATCACGATGCCCAAGCTCTACAACCGATCTCTTTCCGGCACC
AAGTACCTGATCGACGAGTACATCACGCAAATGGCCGAGGCGGTCGAGGATATCAGCACGCTGCCCATGGCCTTG
ACGACGGGGGGGCCGTCGGCGCTGACGAACCAGATGAAGCTCGACTTTATCCACGACGCGAGGCAGGCTTTCGGA
CGCAGCGCGCTGGTGCTTCAGGGGGGAGCCATCTTTGGCCTGTGCCACCTCGGCGTCGTCAAGGCCCTGTTCCTG
CGGGGCCTGCTGCCGCGCATTATCACGGGCACGGCGACGGGCGCCCTCATCGCGGCGCTGGTGGCCATCCACACC
GAGGACGAGCTGCCGCGCATCCTCGAGGGCGACGGCATCGACTTGACGGCCTTTACGAGCCGGCCCGGGGCCGCC
GGTCGGGAGACGCCTCGGCAGCAGACGTTTCGCTCGAGGTGGGATACGCTGATGCGTAGGATCCGACGCTTCTCG
CGGGAAGGCTACTTTCTCGACCTGACGGTGCTCGAGAACTGCGTGCGGGCCAACGTCGACGACCTGACGTTTGAG
GAGGCATACAACCGCAGCAAGCGGATCCTCAACATAACCGTCGCGACCGAGGGCCGAGGCGGCGTGCCGACGCTG
CTCAACTACATCACGGCGCCCAACGTGTTGATCTGGACGGCGGCCATCGCATCCAACGCGTCCTCGCCGTCGTTT
TACGGGAGGCGAGAAGTGATTCTGTGCAAAGACGCGGGTGGTAACGTGGTGCCGTGGGAACCGGCGACGACGACC
GACTTCCGGCACTGGACGCACGCCTCTTACTCGGAGAGGGACTCGCCGCTGCGGCGCACATCAGAGCTCTTCAAC
GTGAACCACTTCATCGTCAGCCAGGCGCGACCGTACTTGATCCCCTTTCTCCAGTCAGACATGCACGGCCCGTCG
TTGGTGGAGGCGCGCAGCAGGGCGACGCAGTTGTCAGCCTTTTTCGCCCGCATGGTCGGGTTGGAGGTGCAGCAC
CGGCTCAGACAGTTGGACACGCTGCGGTTACTGCCGTCGAGCATCCGACGCTTCCTGGTGGACGAGCAGGTGCCC
GGGGCGGCCATGACGCTGGTGCCCGAGGTGACGGCGGGCGACTTTGTGCGTCTCCTGGAGACGCCGACGCGGGAG
ACACTGCAGTACTGGATCCTCCGGGGCGAGAGGAGCGTGTGGCCGGCGGTGGCGGCGCTGCGGATCCGCTGCGCC
GTCGAGTACGAGCTAGACCGGGCCTACCAGGCGGTGCGGAAGCTCAAGGCCGGCGACCTGCGACGTAAGGGGAGC
ATCGCGGGGACCATGGATTACAATGGCCGGCAGTGA
Gene >Ophio5|6090
ATGGGAGCTGTGCTGGCTATCTGGAGTGTGTTTGTCGACGTCGTCTCCTTCTGGCGCAGAGTAAGCTGAAAGGCC
CCTTCAACCTCTCTCCTCTGCCCTGACCGTGGCCGCAGGAGCTCTTCAACTGGTACAATCGAAGGAACCCGGTCG
AGCTGTGGCTAGAACTCCTCCGCAATGCCCAGACATTCGAAGAGTGGGAGGAGGCGGCCCTCCACCTGGACAGTC
TGCTCGGGCTCGATCTATGGTAAACGACTGTTTTTTTTTGTCTTTTTGCCCGAGGTGTCGGCGGCTCAGCTTATG
GATACCATGGCAGGTGCAATAACCCGACGTCGCGAGAATACGACTGGAGGCTCATCACGGACCGGCTCAACTCGT
TGGTCATCGCGAGGGAAGCGGGCAACGTTCAGCTGCTGGTCAACCTCCTCCGCTCCGGCCTCGTGCGAAACCTGG
GCAACATCACGATGCCCAAGCTCTACAACCGATCTCTTTCCGGCACCAAGTACCTGATCGACGAGTACATCACGC
AAATGGCCGAGGCGGTCGAGGATATCAGCACGCTGCCCATGGCCTTGACGACGGGGGGGCCGTCGGCGCTGACGA
ACCAGATGAAGCTCGACTTTATCCACGACGCGAGGCAGGCTTTCGGACGCAGCGCGCTGGTGCTTCAGGGGGGAG
CCATCTTTGGCCTGTGCCACCTCGGCGTCGTCAAGGCCCTGTTCCTGCGGGGCCTGCTGCCGCGCATTATCACGG
GCACGGCGACGGGCGCCCTCATCGCGGCGCTGGTGGCCATCCACACCGAGGACGAGCTGCCGCGCATCCTCGAGG
GCGACGGCATCGACTTGACGGCCTTTACGAGCCGGCCCGGGGCCGCCGGTCGGGAGACGCCTCGGCAGCAGACGT
TTCGCTCGAGGTGGGATACGCTGATGCGTAGGATCCGACGCTTCTCGCGGGAAGGCTACTTTCTCGACCTGACGG
TGCTCGAGAACTGCGTGCGGGCCAACGTCGACGACCTGACGTTTGAGGAGGCATACAACCGCAGCAAGCGGATCC
TCAACATAACCGTCGCGACCGAGGGCCGAGGCGGCGTGCCGACGCTGCTCAACTACATCACGGCGCCCAACGTGG
TAAGTGACGGGAAGGAGGCAAGGACGGCATTCGTTGACTAGGCGACGCAGTTGATCTGGACGGCGGCCATCGCAT
CCAACGCGTCCTCGCCGTCGTTTTACGGGAGGCGAGAAGTGATTCTGTGCAAAGACGCGGGTGGTAACGTGGTGC
CGTGGGAACCGGCGACGACGACCGACTTCCGGCACTGGACGCACGCCTCTTACTCGGAGAGGGACTCGCCGCTGC
GGCGCACATCAGAGCTCTTCAACGTGAACCACTTCATCGTCAGCCAGGCGCGACCGTACTTGATCCCCTTTCTCC
AGTCAGACATGCACGGCCCGTCGTTGGTGGAGGCGCGCAGCAGGGCGACGCAGTTGTCAGCCTTTTTCGCCCGCA
TGGTCGGGTTGGAGGTGCAGCACCGGCTCAGACAGTTGGACACGCTGCGGTTACTGCCGTCGAGCATCCGACGCT
TCCTGGTGGACGAGCAGGTGCCCGGGGCGGCCATGACGCTGGTGCCCGAGGTGACGGCGGGCGACTTTGTGCGTC
TCCTGGAGACGCCGACGCGGGAGACACTGCAGTACTGGATCCTCCGGGGCGAGAGGAGCGTGTGGCCGGCGGTGG
CGGCGCTGCGGATCCGCTGCGCCGTCGAGTACGAGCTAGACCGGGCCTACCAGGCGGTGCGGAAGCTCAAGGCCG
GCGACCTGCGACGTAAGGGGAGCATCGCGGGGACCATGGATTACAATGGCCGGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail