Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6087
Gene name
Locationscaffold_517:8710..11158
Strand+
Gene length (bp)2448
Transcript length (bp)2307
Coding sequence length (bp)2304
Protein length (aa) 768

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 6.8E-24 286 418
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 2.9E-06 519 602

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q68J42|LIPS_PIG Hormone-sensitive lipase OS=Sus scrofa GN=LIPE PE=2 SV=1 276 405 3.0E-20
sp|Q05469|LIPS_HUMAN Hormone-sensitive lipase OS=Homo sapiens GN=LIPE PE=1 SV=4 276 405 1.0E-19
sp|P15304|LIPS_RAT Hormone-sensitive lipase OS=Rattus norvegicus GN=Lipe PE=1 SV=3 276 409 2.0E-19
sp|P16386|LIPS_BOVIN Hormone-sensitive lipase OS=Bos taurus GN=LIPE PE=1 SV=2 276 405 3.0E-19
sp|Q9R101|LIPS_ICTTR Hormone-sensitive lipase OS=Ictidomys tridecemlineatus GN=LIPE PE=2 SV=1 276 405 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q68J42|LIPS_PIG Hormone-sensitive lipase OS=Sus scrofa GN=LIPE PE=2 SV=1 276 405 3.0E-20
sp|Q05469|LIPS_HUMAN Hormone-sensitive lipase OS=Homo sapiens GN=LIPE PE=1 SV=4 276 405 1.0E-19
sp|P15304|LIPS_RAT Hormone-sensitive lipase OS=Rattus norvegicus GN=Lipe PE=1 SV=3 276 409 2.0E-19
sp|P16386|LIPS_BOVIN Hormone-sensitive lipase OS=Bos taurus GN=LIPE PE=1 SV=2 276 405 3.0E-19
sp|Q9R101|LIPS_ICTTR Hormone-sensitive lipase OS=Ictidomys tridecemlineatus GN=LIPE PE=2 SV=1 276 405 5.0E-19
sp|P54310|LIPS_MOUSE Hormone-sensitive lipase OS=Mus musculus GN=Lipe PE=1 SV=2 276 409 6.0E-19
sp|P18773|EST_ACILW Esterase OS=Acinetobacter lwoffii GN=est PE=3 SV=2 279 410 6.0E-13
sp|P24484|LIP2_MORS1 Lipase 2 OS=Moraxella sp. (strain TA144) GN=lip2 PE=1 SV=1 286 378 8.0E-12
sp|O06350|LIPF_MYCTU Carboxylesterase LipF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lipF PE=1 SV=3 279 371 3.0E-07
sp|P22760|AAAD_HUMAN Arylacetamide deacetylase OS=Homo sapiens GN=AADAC PE=1 SV=5 275 378 2.0E-06
sp|A2A7Z8|ADCL3_MOUSE Arylacetamide deacetylase-like 3 OS=Mus musculus GN=Aadacl3 PE=3 SV=1 281 452 2.0E-06
sp|P9WK87|NLHH_MYCTU Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nlhH PE=1 SV=1 286 369 9.0E-06
sp|P9WK86|NLHH_MYCTO Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nlhH PE=3 SV=1 286 369 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 116 133 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6087
MGYAAPSHHYIYLYPHQLRPEPHHHHHGTGRSNPGPIDTAVASHATRPLRIPTQPGPQLASRLFFNLIRHANRLS
FFRVLTTILADILRPFTSNHDRPRPGTALVQVAPTAGPRRLVLLVPAFLATLMYLYAARNFSALAGLASPEPMTN
MYDATYFRATWVLTALDAGFWTAMKIRTKWLRDIAAMVFSLFYLVAAERADEKVRKIRACVTVDHLRVSWNKPTT
PYVGFLQRLVRPRLTRWPPRQLRIPRPSKSDYKEPVVAWLYYDGPLSDLERHKRIILDIPGGGFVAMDPRCHDDR
LLAWASKTGLPVVSIDYGKAPEYPYPYALNECFDAYVTMVRTQGRCIGLSGNEPPRIVLSGDSAGGNLAVATTLM
ILETSSTSFGRCSPQASLPVPDGLVCFYPALDMNIGNWMSDEQMSLIRDREMNKPIVRRKSRQYDELVGTPRKAD
DRSDDHSDEHVNGRVEETAARMSTVTSPHETQPEYSHSGPQTLAAPESTSGKRKSMSHRSEPMKTRLATASMISY
FNDRILGPEMMRAMILLYIGGNNRPDFSKDYLLSPVLAPESLLARFPKIFLMTGERDPLVDDTLVFAGRVRRAKE
AAAARNGCGPDETKAVEVILLPRISHGFMQFPAVFPPAWKYIERSASWFEQLFSESEHARNPHLAPPRRQHGQHV
GESSGDEDNKPLEMGMTKLSRGRSSTPGKGTEPSPSLRGRNSDDAAERKGRTPRRPGLDKKNSLVRLNSGDDLLG
RRMQGLASSLVGLTSDDG
Coding >Ophio5|6087
ATGGGCTACGCAGCGCCCTCCCATCATTACATATACCTATATCCTCACCAGCTTCGTCCAGAACCTCATCATCAC
CACCATGGTACAGGCCGCTCGAACCCCGGTCCTATCGACACAGCGGTAGCTTCACATGCCACCCGCCCCCTCCGC
ATCCCGACCCAGCCGGGCCCCCAATTGGCCAGCCGCCTTTTCTTCAACCTCATCCGCCATGCGAATAGGCTCTCC
TTCTTCAGAGTCCTGACAACGATCTTGGCTGACATCCTCCGGCCCTTTACAAGCAACCATGATAGACCACGTCCT
GGGACGGCCCTCGTCCAAGTCGCGCCGACTGCAGGTCCTCGCCGTCTTGTCCTTCTGGTCCCTGCCTTCTTGGCC
ACCCTCATGTATCTCTATGCCGCCCGCAACTTCAGCGCCCTGGCCGGCCTCGCCAGTCCGGAGCCCATGACCAAC
ATGTACGACGCCACCTACTTCCGCGCTACCTGGGTCCTGACGGCGCTGGACGCCGGCTTCTGGACCGCCATGAAG
ATCCGCACCAAGTGGTTGCGTGACATTGCCGCCATGGTCTTCTCCCTCTTCTATCTCGTCGCCGCCGAGCGGGCC
GACGAAAAGGTACGCAAGATCCGCGCTTGCGTCACCGTCGACCACCTGCGCGTGTCATGGAACAAGCCGACGACG
CCCTACGTTGGCTTCCTTCAGCGTCTCGTCCGGCCGCGCCTCACTCGCTGGCCGCCGCGTCAGTTGCGCATCCCG
CGTCCGAGCAAGAGCGATTACAAGGAGCCCGTCGTCGCCTGGCTCTACTACGACGGCCCGCTCTCCGACCTCGAG
CGCCACAAGCGCATCATCCTCGACATTCCCGGCGGCGGCTTCGTTGCCATGGACCCTCGCTGTCACGACGACAGG
CTGCTGGCCTGGGCCTCCAAGACGGGCTTGCCAGTCGTCAGCATCGACTACGGAAAGGCGCCCGAGTACCCCTAT
CCTTACGCCCTCAACGAGTGCTTCGATGCCTACGTCACCATGGTCCGCACACAGGGCCGCTGTATCGGCTTGTCG
GGCAACGAGCCGCCTCGCATCGTTCTCTCCGGCGACAGCGCCGGCGGCAACCTTGCCGTGGCGACGACGCTCATG
ATCCTCGAGACGAGCAGCACGTCGTTCGGGCGGTGCTCGCCGCAAGCAAGTCTGCCCGTACCGGATGGCCTCGTC
TGCTTCTACCCGGCTCTCGACATGAACATTGGCAACTGGATGTCGGACGAGCAAATGTCACTGATCCGCGACCGC
GAGATGAACAAACCGATTGTACGGCGCAAGAGCAGGCAGTACGACGAGCTCGTCGGCACTCCCCGGAAGGCCGAT
GACCGATCTGACGACCATTCGGATGAGCACGTCAACGGCAGGGTCGAGGAGACAGCGGCACGGATGAGTACGGTG
ACGAGCCCGCACGAGACACAACCCGAGTATTCGCATTCCGGGCCGCAGACGCTCGCCGCGCCGGAGAGCACGTCG
GGGAAGCGGAAGAGCATGTCGCACCGGTCGGAGCCGATGAAGACGCGGCTTGCGACGGCGTCGATGATTTCCTAC
TTTAACGACCGTATCTTGGGGCCCGAGATGATGCGAGCCATGATTCTCTTGTACATTGGAGGGAACAACCGGCCG
GACTTTAGCAAAGACTACCTGCTGAGTCCCGTGCTCGCGCCCGAGTCGCTGCTGGCGCGATTCCCCAAGATCTTT
TTGATGACGGGAGAGCGAGATCCGCTGGTGGACGACACTCTCGTCTTCGCTGGAAGGGTCAGGCGCGCCAAGGAG
GCGGCAGCAGCCCGCAACGGGTGCGGCCCGGATGAGACCAAGGCGGTCGAGGTGATACTGCTGCCGCGCATCTCT
CACGGCTTCATGCAGTTCCCGGCTGTGTTCCCTCCGGCGTGGAAATACATTGAGCGAAGCGCCAGCTGGTTCGAA
CAGCTCTTCAGCGAGTCGGAGCACGCGCGCAACCCGCATCTCGCGCCGCCGCGGCGGCAGCACGGGCAGCACGTC
GGCGAGTCGAGCGGCGACGAGGACAACAAGCCGCTGGAGATGGGCATGACGAAGCTGTCCCGAGGCCGCAGCTCG
ACGCCCGGCAAAGGAACCGAGCCGTCTCCGTCGTTGCGGGGCAGGAACTCGGACGACGCAGCGGAGCGAAAGGGC
CGGACGCCGAGGAGGCCGGGGCTGGACAAGAAGAACAGCCTGGTGAGGCTCAACAGCGGCGACGACCTGCTGGGA
CGGCGGATGCAGGGGCTGGCGAGCTCTCTGGTGGGACTGACGAGCGATGACGGC
Transcript >Ophio5|6087
ATGGGCTACGCAGCGCCCTCCCATCATTACATATACCTATATCCTCACCAGCTTCGTCCAGAACCTCATCATCAC
CACCATGGTACAGGCCGCTCGAACCCCGGTCCTATCGACACAGCGGTAGCTTCACATGCCACCCGCCCCCTCCGC
ATCCCGACCCAGCCGGGCCCCCAATTGGCCAGCCGCCTTTTCTTCAACCTCATCCGCCATGCGAATAGGCTCTCC
TTCTTCAGAGTCCTGACAACGATCTTGGCTGACATCCTCCGGCCCTTTACAAGCAACCATGATAGACCACGTCCT
GGGACGGCCCTCGTCCAAGTCGCGCCGACTGCAGGTCCTCGCCGTCTTGTCCTTCTGGTCCCTGCCTTCTTGGCC
ACCCTCATGTATCTCTATGCCGCCCGCAACTTCAGCGCCCTGGCCGGCCTCGCCAGTCCGGAGCCCATGACCAAC
ATGTACGACGCCACCTACTTCCGCGCTACCTGGGTCCTGACGGCGCTGGACGCCGGCTTCTGGACCGCCATGAAG
ATCCGCACCAAGTGGTTGCGTGACATTGCCGCCATGGTCTTCTCCCTCTTCTATCTCGTCGCCGCCGAGCGGGCC
GACGAAAAGGTACGCAAGATCCGCGCTTGCGTCACCGTCGACCACCTGCGCGTGTCATGGAACAAGCCGACGACG
CCCTACGTTGGCTTCCTTCAGCGTCTCGTCCGGCCGCGCCTCACTCGCTGGCCGCCGCGTCAGTTGCGCATCCCG
CGTCCGAGCAAGAGCGATTACAAGGAGCCCGTCGTCGCCTGGCTCTACTACGACGGCCCGCTCTCCGACCTCGAG
CGCCACAAGCGCATCATCCTCGACATTCCCGGCGGCGGCTTCGTTGCCATGGACCCTCGCTGTCACGACGACAGG
CTGCTGGCCTGGGCCTCCAAGACGGGCTTGCCAGTCGTCAGCATCGACTACGGAAAGGCGCCCGAGTACCCCTAT
CCTTACGCCCTCAACGAGTGCTTCGATGCCTACGTCACCATGGTCCGCACACAGGGCCGCTGTATCGGCTTGTCG
GGCAACGAGCCGCCTCGCATCGTTCTCTCCGGCGACAGCGCCGGCGGCAACCTTGCCGTGGCGACGACGCTCATG
ATCCTCGAGACGAGCAGCACGTCGTTCGGGCGGTGCTCGCCGCAAGCAAGTCTGCCCGTACCGGATGGCCTCGTC
TGCTTCTACCCGGCTCTCGACATGAACATTGGCAACTGGATGTCGGACGAGCAAATGTCACTGATCCGCGACCGC
GAGATGAACAAACCGATTGTACGGCGCAAGAGCAGGCAGTACGACGAGCTCGTCGGCACTCCCCGGAAGGCCGAT
GACCGATCTGACGACCATTCGGATGAGCACGTCAACGGCAGGGTCGAGGAGACAGCGGCACGGATGAGTACGGTG
ACGAGCCCGCACGAGACACAACCCGAGTATTCGCATTCCGGGCCGCAGACGCTCGCCGCGCCGGAGAGCACGTCG
GGGAAGCGGAAGAGCATGTCGCACCGGTCGGAGCCGATGAAGACGCGGCTTGCGACGGCGTCGATGATTTCCTAC
TTTAACGACCGTATCTTGGGGCCCGAGATGATGCGAGCCATGATTCTCTTGTACATTGGAGGGAACAACCGGCCG
GACTTTAGCAAAGACTACCTGCTGAGTCCCGTGCTCGCGCCCGAGTCGCTGCTGGCGCGATTCCCCAAGATCTTT
TTGATGACGGGAGAGCGAGATCCGCTGGTGGACGACACTCTCGTCTTCGCTGGAAGGGTCAGGCGCGCCAAGGAG
GCGGCAGCAGCCCGCAACGGGTGCGGCCCGGATGAGACCAAGGCGGTCGAGGTGATACTGCTGCCGCGCATCTCT
CACGGCTTCATGCAGTTCCCGGCTGTGTTCCCTCCGGCGTGGAAATACATTGAGCGAAGCGCCAGCTGGTTCGAA
CAGCTCTTCAGCGAGTCGGAGCACGCGCGCAACCCGCATCTCGCGCCGCCGCGGCGGCAGCACGGGCAGCACGTC
GGCGAGTCGAGCGGCGACGAGGACAACAAGCCGCTGGAGATGGGCATGACGAAGCTGTCCCGAGGCCGCAGCTCG
ACGCCCGGCAAAGGAACCGAGCCGTCTCCGTCGTTGCGGGGCAGGAACTCGGACGACGCAGCGGAGCGAAAGGGC
CGGACGCCGAGGAGGCCGGGGCTGGACAAGAAGAACAGCCTGGTGAGGCTCAACAGCGGCGACGACCTGCTGGGA
CGGCGGATGCAGGGGCTGGCGAGCTCTCTGGTGGGACTGACGAGCGATGACGGCTGA
Gene >Ophio5|6087
ATGGGCTACGCAGCGCCCTCCCATCATTACATATACCTATATCCTCACCAGCTTCGTCCAGAACCTCATCATCAC
CACCATGGTACAGGCCGCTCGAACCCCGGTCCTATCGACACAGCGGGTACCTACCTCTTTCGGCCGGGCGTGGAA
TGCTAGCTGACGACTCTATCACTATAGTAGCTTCACATGCCACCCGCCCCCTCCGCATCCCGACCCAGCCGGGCC
CCCAATTGGCCAGCCGCCTTTTCTTCAACCTCATCCGCCATGCGAATAGGCTCTCCTTCTTCAGAGTCCTGACAA
CGATCTTGGCTGACATCCTCCGGCCCTTTACAAGCAACCATGATAGACCACGTCCTGGGACGGCCCTCGTCCAAG
TCGCGCCGACTGCAGGTCCTCGCCGTCTTGTCCTTCTGGTCCCTGTATCTCGCCAAGGGCCCTAGTCATGGACCG
CCTGGCCTTCAGCGGCTCTCGCGCCTACTGTCGAAACGCATGACGGCCTGGCAGGCCTTCTTGGCCACCCTCATG
TATCTCTATGCCGCCCGCAACTTCAGCGCCCTGGCCGGCCTCGCCAGTCCGGAGCCCATGACCAACATGTACGAC
GCCACCTACTTCCGCGCTACCTGGGTCCTGACGGCGCTGGACGCCGGCTTCTGGACCGCCATGAAGATCCGCACC
AAGTGGTTGCGTGACATTGCCGCCATGGTCTTCTCCCTCTTCTATCTCGTCGCCGCCGAGCGGGCCGACGAAAAG
GTACGCAAGATCCGCGCTTGCGTCACCGTCGACCACCTGCGCGTGTCATGGAACAAGCCGACGACGCCCTACGTT
GGCTTCCTTCAGCGTCTCGTCCGGCCGCGCCTCACTCGCTGGCCGCCGCGTCAGTTGCGCATCCCGCGTCCGAGC
AAGAGCGATTACAAGGAGCCCGTCGTCGCCTGGCTCTACTACGACGGCCCGCTCTCCGACCTCGAGCGCCACAAG
CGCATCATCCTCGACATTCCCGGCGGCGGCTTCGTTGCCATGGACCCTCGCTGTCACGACGACAGGCTGCTGGCC
TGGGCCTCCAAGACGGGCTTGCCAGTCGTCAGCATCGACTACGGAAAGGCGCCCGAGTACCCCTATCCTTACGCC
CTCAACGAGTGCTTCGATGCCTACGTCACCATGGTCCGCACACAGGGCCGCTGTATCGGCTTGTCGGGCAACGAG
CCGCCTCGCATCGTTCTCTCCGGCGACAGCGCCGGCGGCAACCTTGCCGTGGCGACGACGCTCATGATCCTCGAG
ACGAGCAGCACGTCGTTCGGGCGGTGCTCGCCGCAAGCAAGTCTGCCCGTACCGGATGGCCTCGTCTGCTTCTAC
CCGGCTCTCGACATGAACATTGGCAACTGGATGTCGGACGAGCAAATGTCACTGATCCGCGACCGCGAGATGAAC
AAACCGATTGTACGGCGCAAGAGCAGGCAGTACGACGAGCTCGTCGGCACTCCCCGGAAGGCCGATGACCGATCT
GACGACCATTCGGATGAGCACGTCAACGGCAGGGTCGAGGAGACAGCGGCACGGATGAGTACGGTGACGAGCCCG
CACGAGACACAACCCGAGTATTCGCATTCCGGGCCGCAGACGCTCGCCGCGCCGGAGAGCACGTCGGGGAAGCGG
AAGAGCATGTCGCACCGGTCGGAGCCGATGAAGACGCGGCTTGCGACGGCGTCGATGATTTCCTACTTTAACGAC
CGTATCTTGGGGCCCGAGATGATGCGAGCCATGATTCTCTTGTACATTGGAGGGAACAACCGGCCGGACTTTAGC
AAAGACTACCTGCTGAGTCCCGTGCTCGCGCCCGAGTCGCTGCTGGCGCGATTCCCCAAGATCTTTTTGATGACG
GGAGAGCGAGATCCGCTGGTGGACGACACTCTCGTCTTCGCTGGAAGGGTCAGGCGCGCCAAGGAGGCGGCAGCA
GCCCGCAACGGGTGCGGCCCGGATGAGACCAAGGCGGTCGAGGTGATACTGCTGCCGCGCATCTCTCACGGCTTC
ATGCAGTTCCCGGCTGTGTTCCCTCCGGCGTGGAAATACATTGAGCGAAGCGCCAGCTGGTTCGAACAGCTCTTC
AGCGAGTCGGAGCACGCGCGCAACCCGCATCTCGCGCCGCCGCGGCGGCAGCACGGGCAGCACGTCGGCGAGTCG
AGCGGCGACGAGGACAACAAGCCGCTGGAGATGGGCATGACGAAGCTGTCCCGAGGCCGCAGCTCGACGCCCGGC
AAAGGAACCGAGCCGTCTCCGTCGTTGCGGGGCAGGAACTCGGACGACGCAGCGGAGCGAAAGGGCCGGACGCCG
AGGAGGCCGGGGCTGGACAAGAAGAACAGCCTGGTGAGGCTCAACAGCGGCGACGACCTGCTGGGACGGCGGATG
CAGGGGCTGGCGAGCTCTCTGGTGGGACTGACGAGCGATGACGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail