Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6080
Gene name
Locationscaffold_516:2424..4106
Strand-
Gene length (bp)1682
Transcript length (bp)1506
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09451 ATG27 Autophagy-related protein 27 6.2E-93 184 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B086|ATG27_ARTBC Autophagy-related protein 27 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01857 PE=1 SV=1 179 447 6.0E-29
sp|Q6CBS9|ATG27_YARLI Autophagy-related protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG27 PE=3 SV=1 179 501 2.0E-28
sp|A7KAK7|ATG27_PICAN Autophagy-related protein 27 OS=Pichia angusta GN=ATG27 PE=3 SV=1 397 501 8.0E-11
sp|A3LW83|ATG27_PICST Autophagy-related protein 27 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG27 PE=3 SV=2 175 501 3.0E-10
sp|Q5A5S7|ATG27_CANAL Autophagy-related protein 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG27 PE=3 SV=1 181 501 8.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B086|ATG27_ARTBC Autophagy-related protein 27 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01857 PE=1 SV=1 179 447 6.0E-29
sp|Q6CBS9|ATG27_YARLI Autophagy-related protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG27 PE=3 SV=1 179 501 2.0E-28
sp|A7KAK7|ATG27_PICAN Autophagy-related protein 27 OS=Pichia angusta GN=ATG27 PE=3 SV=1 397 501 8.0E-11
sp|A3LW83|ATG27_PICST Autophagy-related protein 27 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG27 PE=3 SV=2 175 501 3.0E-10
sp|Q5A5S7|ATG27_CANAL Autophagy-related protein 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG27 PE=3 SV=1 181 501 8.0E-10
sp|Q6BM18|ATG27_DEBHA Autophagy-related protein 27 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG27 PE=3 SV=2 178 501 7.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 430 452 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6080
MGYQKVEEGERVLRQLQSGSNHDLRPLRLSVRRSSPDRAPDQALDRARHVRLHLGARCGKAEARHIRGHGPEEAS
AAKQGVHNPWPLDPREQSLTRLAPSLCVRLRRKIRKKKKKKKRLCRVTNRLVSAIAEDRTPSCRGRSPFFIPLPP
PPFLHLSPSSVLLVCDVMHPPQLSWTLALGLVAFAPLRGAAMLRCDNVRVDGQSFDLSQLSGPHSVVTSRYESIP
DAHHNTTYTLDICKPLKKIGKRKKTEECPNGTRVCAIQRFLQGDKNVVEEVVAIAGSLENVGGSQFEYEATRLKT
SNSNSDSQKEGLRLVLKGGKNPLVGPVGERREQRAVVEFLCDPKRKGDEGEWEAEDKYDTRAADDKGNDGKDQSA
IEHQLKKEGAALIWESYGREKDADVLRLTWHTKWACERRDGDKDGGGSSSSHWGFFTWFVLIVFLGIAAYLIFGS
WLNYNRYGARGWDLIPHGDAIRDVPYLLKDWLRRVLNTVQGTGSRGGYSAV
Coding >Ophio5|6080
ATGGGATATCAAAAGGTAGAAGAGGGCGAACGTGTCTTGCGACAGCTTCAAAGCGGTTCGAACCACGATCTTCGG
CCCCTTCGTCTCTCAGTCCGTCGATCATCTCCTGACCGGGCACCTGACCAGGCCCTTGACCGGGCACGTCACGTG
CGTCTCCACCTCGGTGCAAGGTGCGGAAAAGCTGAAGCGCGTCACATCCGAGGCCACGGGCCAGAAGAGGCCTCA
GCTGCAAAACAAGGAGTGCATAACCCGTGGCCTCTTGATCCACGCGAGCAATCTCTCACCCGACTGGCTCCGAGT
CTTTGCGTCCGACTCCGACGAAAAATCAGAAAGAAGAAGAAGAAGAAGAAGAGGCTCTGTCGTGTGACAAACAGG
CTGGTCAGCGCTATCGCTGAAGACCGGACCCCATCGTGCCGCGGCCGGTCCCCCTTTTTTATTCCCCTCCCCCCT
CCCCCCTTCCTTCACCTCAGCCCGTCGTCTGTGCTCCTCGTTTGCGACGTCATGCATCCGCCGCAATTATCTTGG
ACGCTGGCCCTCGGCCTCGTCGCCTTCGCGCCGCTTCGGGGTGCGGCCATGTTGAGGTGCGATAATGTGCGGGTC
GATGGCCAAAGCTTCGATCTCTCGCAACTCAGTGGTCCCCACTCGGTTGTCACTTCGCGCTACGAGTCGATCCCG
GACGCTCATCACAACACGACCTATACGCTGGATATCTGCAAGCCGTTGAAGAAGATCGGTAAGAGGAAGAAGACG
GAGGAGTGCCCCAACGGAACCAGAGTGTGTGCCATCCAGCGTTTCCTGCAGGGAGATAAGAACGTGGTGGAGGAG
GTGGTGGCCATCGCCGGCTCGCTGGAGAACGTGGGTGGTTCGCAGTTCGAGTATGAGGCCACGCGGCTCAAGACG
AGCAACTCCAACAGCGACTCGCAAAAGGAGGGCCTGAGGCTCGTGCTCAAGGGCGGCAAGAATCCGCTCGTCGGG
CCCGTCGGGGAACGTCGCGAGCAGAGGGCCGTCGTCGAGTTCCTGTGCGACCCTAAAAGGAAGGGAGATGAGGGC
GAGTGGGAGGCCGAGGACAAGTACGACACGAGGGCAGCCGACGACAAGGGCAACGATGGCAAGGACCAGTCGGCC
ATCGAGCACCAACTCAAGAAGGAGGGCGCCGCTCTCATATGGGAGAGCTACGGGCGGGAAAAGGACGCCGACGTT
TTGCGGCTGACTTGGCACACCAAATGGGCGTGCGAGAGGCGCGACGGCGATAAGGACGGCGGTGGGAGCAGCAGC
AGCCACTGGGGGTTCTTCACCTGGTTCGTCCTCATCGTCTTCCTCGGCATCGCCGCCTACCTCATCTTCGGATCG
TGGCTCAACTACAACCGCTACGGTGCCAGAGGCTGGGACCTGATCCCCCACGGCGACGCCATCCGCGACGTGCCC
TACCTGCTCAAGGACTGGTTGAGGAGGGTGCTCAACACGGTGCAGGGCACGGGCAGCAGGGGAGGATACAGCGCA
GTC
Transcript >Ophio5|6080
ATGGGATATCAAAAGGTAGAAGAGGGCGAACGTGTCTTGCGACAGCTTCAAAGCGGTTCGAACCACGATCTTCGG
CCCCTTCGTCTCTCAGTCCGTCGATCATCTCCTGACCGGGCACCTGACCAGGCCCTTGACCGGGCACGTCACGTG
CGTCTCCACCTCGGTGCAAGGTGCGGAAAAGCTGAAGCGCGTCACATCCGAGGCCACGGGCCAGAAGAGGCCTCA
GCTGCAAAACAAGGAGTGCATAACCCGTGGCCTCTTGATCCACGCGAGCAATCTCTCACCCGACTGGCTCCGAGT
CTTTGCGTCCGACTCCGACGAAAAATCAGAAAGAAGAAGAAGAAGAAGAAGAGGCTCTGTCGTGTGACAAACAGG
CTGGTCAGCGCTATCGCTGAAGACCGGACCCCATCGTGCCGCGGCCGGTCCCCCTTTTTTATTCCCCTCCCCCCT
CCCCCCTTCCTTCACCTCAGCCCGTCGTCTGTGCTCCTCGTTTGCGACGTCATGCATCCGCCGCAATTATCTTGG
ACGCTGGCCCTCGGCCTCGTCGCCTTCGCGCCGCTTCGGGGTGCGGCCATGTTGAGGTGCGATAATGTGCGGGTC
GATGGCCAAAGCTTCGATCTCTCGCAACTCAGTGGTCCCCACTCGGTTGTCACTTCGCGCTACGAGTCGATCCCG
GACGCTCATCACAACACGACCTATACGCTGGATATCTGCAAGCCGTTGAAGAAGATCGGTAAGAGGAAGAAGACG
GAGGAGTGCCCCAACGGAACCAGAGTGTGTGCCATCCAGCGTTTCCTGCAGGGAGATAAGAACGTGGTGGAGGAG
GTGGTGGCCATCGCCGGCTCGCTGGAGAACGTGGGTGGTTCGCAGTTCGAGTATGAGGCCACGCGGCTCAAGACG
AGCAACTCCAACAGCGACTCGCAAAAGGAGGGCCTGAGGCTCGTGCTCAAGGGCGGCAAGAATCCGCTCGTCGGG
CCCGTCGGGGAACGTCGCGAGCAGAGGGCCGTCGTCGAGTTCCTGTGCGACCCTAAAAGGAAGGGAGATGAGGGC
GAGTGGGAGGCCGAGGACAAGTACGACACGAGGGCAGCCGACGACAAGGGCAACGATGGCAAGGACCAGTCGGCC
ATCGAGCACCAACTCAAGAAGGAGGGCGCCGCTCTCATATGGGAGAGCTACGGGCGGGAAAAGGACGCCGACGTT
TTGCGGCTGACTTGGCACACCAAATGGGCGTGCGAGAGGCGCGACGGCGATAAGGACGGCGGTGGGAGCAGCAGC
AGCCACTGGGGGTTCTTCACCTGGTTCGTCCTCATCGTCTTCCTCGGCATCGCCGCCTACCTCATCTTCGGATCG
TGGCTCAACTACAACCGCTACGGTGCCAGAGGCTGGGACCTGATCCCCCACGGCGACGCCATCCGCGACGTGCCC
TACCTGCTCAAGGACTGGTTGAGGAGGGTGCTCAACACGGTGCAGGGCACGGGCAGCAGGGGAGGATACAGCGCA
GTCTGA
Gene >Ophio5|6080
ATGGGATATCAAAAGGTAGAAGAGGGCGAACGTGTCTTGCGACAGCTTCAGTCTTTGATCTCTCAACTACAAGGG
TTTTTTTTTTTATATAATTCAGTTTTAGAAGCGGTTCGAACCACGATCTTCGGCCCCTTCGTCTCTCAGTCCGTC
GATCATCTCCTGACCGGGCACCTGACCAGGCCCTTGACCGGGCACGTCACGTGCGTCTCCACCTCGGTGCAAGGT
GCGGAAAAGCTGAAGCGCGTCACATCCGAGGCCACGGGCCAGAAGAGGCCTCAGCTGCAAAACAAGGAGTGCATA
ACCCGTGGCCTCTTGATCCACGCGAGCAATCTCTCACCCGACTGGCTCCGAGTCTTTGCGTCCGACTCCGACGAA
AAATCAGAAAGAAGAAGAAGAAGAAGAAGAGGCTCTGTCGTGTGACAAACAGGCTGGTCAGCGCTATCGCTGAAG
ACCGGACCCCATCGTGCCGCGGCCGGTCCCCCTTTTTTATTCCCCTCCCCCCTCCCCCCTTCCTTCACCTCAGCC
CGTCGTCTGTGCTCCTCGTTTGCGACGTCATGCATCCGCCGCAATTATCTTGGACGCTGGCCCTCGGCCTCGTCG
CCTTCGCGCCGCTTCGGGGTGCGGCCATGTTGAGGTGCGATAATGTGCGGGTCGATGGCCAAAGCTTCGATCTCT
CGCAACTCAGTGGTCCCCACTCGGTTGTCACTTCGCGCTACGAGTCGATCCCGGACGCTCATCACAACACGACCT
ATACGCTGGATATCTGCAAGCCGTTGAAGAAGATCGGTAAGAGGAAGAAGACGGAGGAGTGCCCCAACGGAACCA
GAGGTGTGCTATCAATCAATGCTCTCCTGCCAGCAAAAGCCAACTGACCGTCGCCACTCAGTGTGTGCCATCCAG
CGTTTCCTGCAGGGAGATAAGAACGTGGTGGAGGAGGTGGTGGCCATCGCCGGCTCGCTGGAGAACGTGGGTGGT
TCGCAGTTCGAGTATGAGGCCACGCGGCTCAAGACGAGCAACTCCAACAGCGACTCGCAAAAGGAGGGCCTGAGG
CTCGTGCTCAAGGGCGGCAAGAATCCGCTCGTCGGGCCCGTCGGGGAACGTCGCGAGCAGAGGGCCGTCGTCGAG
TTCCTGTGCGACCCTAAAAGGAAGGGAGATGAGGGCGAGTGGGAGGCCGAGGACAAGTACGACACGAGGGCAGCC
GACGACAAGGGCAACGATGGCAAGGACCAGTCGGCCATCGAGCACCAACTCAAGAAGGAGGGCGCCGCTCTCATA
TGGGAGAGCTACGGGCGGGAAAAGGACGCCGACGTTTTGCGGCTGACTTGGCACACCAAATGGGCGTGCGAGAGG
CGCGACGGCGATAAGGACGGCGGTGGGAGCAGCAGCAGCCACTGGGGGTTCTTCACCTGGTTCGTCCTCATGTGA
GTCTTCCTTTGCTGGCCGAGTCGAGTCCAGAGCGCGTGCTCATGCTAACGACGAGCTACAGCGTCTTCCTCGGCA
TCGCCGCCTACCTCATCTTCGGATCGTGGCTCAACTACAACCGCTACGGTGCCAGAGGCTGGGACCTGATCCCCC
ACGGCGACGCCATCCGCGACGTGCCCTACCTGCTCAAGGACTGGTTGAGGAGGGTGCTCAACACGGTGCAGGGCA
CGGGCAGCAGGGGAGGATACAGCGCAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail