Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6076
Gene name
Locationscaffold_515:8939..10932
Strand-
Gene length (bp)1993
Transcript length (bp)1629
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 3.2E-12 125 365

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 6 485 5.0E-24
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 6 485 1.0E-23
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 6 401 6.0E-18
sp|A9IQZ6|HSCA_BORPD Chaperone protein HscA homolog OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hscA PE=3 SV=1 4 327 5.0E-12
sp|B9DNK0|DNAK_STACT Chaperone protein DnaK OS=Staphylococcus carnosus (strain TM300) GN=dnaK PE=3 SV=1 7 366 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 6 485 5.0E-24
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 6 485 1.0E-23
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 6 401 6.0E-18
sp|A9IQZ6|HSCA_BORPD Chaperone protein HscA homolog OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hscA PE=3 SV=1 4 327 5.0E-12
sp|B9DNK0|DNAK_STACT Chaperone protein DnaK OS=Staphylococcus carnosus (strain TM300) GN=dnaK PE=3 SV=1 7 366 1.0E-11
sp|P64408|DNAK_STAAW Chaperone protein DnaK OS=Staphylococcus aureus (strain MW2) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|A8Z4B9|DNAK_STAAT Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|Q6G8Y7|DNAK_STAAS Chaperone protein DnaK OS=Staphylococcus aureus (strain MSSA476) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|Q6GGC0|DNAK_STAAR Chaperone protein DnaK OS=Staphylococcus aureus (strain MRSA252) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|P99110|DNAK_STAAN Chaperone protein DnaK OS=Staphylococcus aureus (strain N315) GN=dnaK PE=1 SV=1 7 327 1.0E-11
sp|P64407|DNAK_STAAM Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|A6QHC3|DNAK_STAAE Chaperone protein DnaK OS=Staphylococcus aureus (strain Newman) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|Q5HFI0|DNAK_STAAC Chaperone protein DnaK OS=Staphylococcus aureus (strain COL) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|A5ITA8|DNAK_STAA9 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH9) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|Q2FXZ2|DNAK_STAA8 Chaperone protein DnaK OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|Q2FGE3|DNAK_STAA3 Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|A6U252|DNAK_STAA2 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH1) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|A7X2Y1|DNAK_STAA1 Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|A6LRN4|DNAK_CLOB8 Chaperone protein DnaK OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|P45554|DNAK_STAAU Chaperone protein DnaK OS=Staphylococcus aureus GN=dnaK PE=3 SV=1 7 327 1.0E-11
sp|Q49Y22|DNAK_STAS1 Chaperone protein DnaK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaK PE=3 SV=1 7 366 3.0E-11
sp|A9KKU0|DNAK_CLOPH Chaperone protein DnaK OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaK PE=3 SV=1 7 456 6.0E-11
sp|Q2YT47|DNAK_STAAB Chaperone protein DnaK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaK PE=3 SV=1 7 366 6.0E-11
sp|Q4L6T0|DNAK_STAHJ Chaperone protein DnaK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dnaK PE=3 SV=1 7 327 7.0E-11
sp|Q6AC76|DNAK_LEIXX Chaperone protein DnaK OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaK PE=3 SV=1 8 327 9.0E-11
sp|B5YAR3|DNAK_DICT6 Chaperone protein DnaK OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaK PE=3 SV=1 7 203 1.0E-10
sp|A8FFD2|DNAK_BACP2 Chaperone protein DnaK OS=Bacillus pumilus (strain SAFR-032) GN=dnaK PE=3 SV=1 7 203 1.0E-10
sp|B8DYH6|DNAK_DICTD Chaperone protein DnaK OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=dnaK PE=3 SV=1 7 203 1.0E-10
sp|A6LM32|DNAK_THEM4 Chaperone protein DnaK OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaK PE=3 SV=1 4 364 1.0E-10
sp|P05646|DNAK_BACME Chaperone protein DnaK OS=Bacillus megaterium GN=dnaK PE=3 SV=3 7 203 2.0E-10
sp|A4J7F3|DNAK_DESRM Chaperone protein DnaK OS=Desulfotomaculum reducens (strain MI-1) GN=dnaK PE=3 SV=1 7 235 2.0E-10
sp|C3L3G7|DNAK_CLOB6 Chaperone protein DnaK OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dnaK PE=3 SV=1 7 327 2.0E-10
sp|Q8Y0L9|HSCA_RALSO Chaperone protein HscA homolog OS=Ralstonia solanacearum (strain GMI1000) GN=hscA PE=3 SV=1 4 327 2.0E-10
sp|Q8CP17|DNAK_STAES Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaK PE=3 SV=1 7 198 2.0E-10
sp|B2V2I5|DNAK_CLOBA Chaperone protein DnaK OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaK PE=3 SV=1 7 327 2.0E-10
sp|Q5HNW6|DNAK_STAEQ Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaK PE=3 SV=1 7 198 2.0E-10
sp|B1L9B4|DNAK_THESQ Chaperone protein DnaK OS=Thermotoga sp. (strain RQ2) GN=dnaK PE=3 SV=1 1 328 2.0E-10
sp|A5IK42|DNAK_THEP1 Chaperone protein DnaK OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaK PE=3 SV=1 1 328 2.0E-10
sp|Q9WYK6|DNAK_THEMA Chaperone protein DnaK OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaK PE=3 SV=1 1 328 2.0E-10
sp|B2TLZ7|DNAK_CLOBB Chaperone protein DnaK OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaK PE=3 SV=1 7 327 2.0E-10
sp|Q8K9Y8|DNAK_BUCAP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaK PE=3 SV=1 7 366 2.0E-10
sp|B0S1F8|DNAK_FINM2 Chaperone protein DnaK OS=Finegoldia magna (strain ATCC 29328) GN=dnaK PE=3 SV=1 7 327 2.0E-10
sp|Q45551|DNAK_GEOSE Chaperone protein DnaK OS=Geobacillus stearothermophilus GN=dnaK PE=3 SV=2 7 198 2.0E-10
sp|B1ILM3|DNAK_CLOBK Chaperone protein DnaK OS=Clostridium botulinum (strain Okra / Type B1) GN=dnaK PE=3 SV=1 7 327 3.0E-10
sp|B9KBT4|DNAK_THENN Chaperone protein DnaK OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaK PE=3 SV=1 1 328 3.0E-10
sp|B1KZN7|DNAK_CLOBM Chaperone protein DnaK OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dnaK PE=3 SV=1 7 327 3.0E-10
sp|A7GHH6|DNAK_CLOBL Chaperone protein DnaK OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dnaK PE=3 SV=1 7 327 3.0E-10
sp|C1FVU0|DNAK_CLOBJ Chaperone protein DnaK OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dnaK PE=3 SV=1 7 327 3.0E-10
sp|A5I640|DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dnaK PE=3 SV=1 7 327 3.0E-10
sp|A7FXL5|DNAK_CLOB1 Chaperone protein DnaK OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dnaK PE=3 SV=1 7 327 3.0E-10
sp|B9IY81|DNAK_BACCQ Chaperone protein DnaK OS=Bacillus cereus (strain Q1) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|B7HPL3|DNAK_BACC7 Chaperone protein DnaK OS=Bacillus cereus (strain AH187) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|Q730M1|DNAK_BACC1 Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|C5D4U1|DNAK_GEOSW Chaperone protein DnaK OS=Geobacillus sp. (strain WCH70) GN=dnaK PE=3 SV=1 7 198 4.0E-10
sp|Q6HDK7|DNAK_BACHK Chaperone protein DnaK OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|Q634M7|DNAK_BACCZ Chaperone protein DnaK OS=Bacillus cereus (strain ZK / E33L) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|Q818E9|DNAK_BACCR Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|B7HCU0|DNAK_BACC4 Chaperone protein DnaK OS=Bacillus cereus (strain B4264) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|C1ESK8|DNAK_BACC3 Chaperone protein DnaK OS=Bacillus cereus (strain 03BB102) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|B7JN39|DNAK_BACC0 Chaperone protein DnaK OS=Bacillus cereus (strain AH820) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|Q81LS2|DNAK_BACAN Chaperone protein DnaK OS=Bacillus anthracis GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|A0RIT3|DNAK_BACAH Chaperone protein DnaK OS=Bacillus thuringiensis (strain Al Hakam) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|C3L5R7|DNAK_BACAC Chaperone protein DnaK OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|C3P8M0|DNAK_BACAA Chaperone protein DnaK OS=Bacillus anthracis (strain A0248) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|Q9KWS7|DNAK_GEOTM Chaperone protein DnaK OS=Geobacillus thermoglucosidasius GN=dnaK PE=3 SV=3 7 198 4.0E-10
sp|B7IYG7|DNAK_BACC2 Chaperone protein DnaK OS=Bacillus cereus (strain G9842) GN=dnaK PE=3 SV=1 7 203 4.0E-10
sp|Q47HK2|DNAK_DECAR Chaperone protein DnaK OS=Dechloromonas aromatica (strain RCB) GN=dnaK PE=3 SV=1 7 477 4.0E-10
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 7 364 5.0E-10
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 7 364 5.0E-10
sp|B2GBQ5|DNAK_LACF3 Chaperone protein DnaK OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaK PE=3 SV=1 1 203 5.0E-10
sp|B2G6W3|DNAK_LACRJ Chaperone protein DnaK OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaK PE=3 SV=1 1 366 6.0E-10
sp|A5VJE7|DNAK_LACRD Chaperone protein DnaK OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaK PE=3 SV=1 1 366 6.0E-10
sp|A0AIS4|DNAK_LISW6 Chaperone protein DnaK OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaK PE=3 SV=1 7 327 6.0E-10
sp|Q0SRE3|DNAK_CLOPS Chaperone protein DnaK OS=Clostridium perfringens (strain SM101 / Type A) GN=dnaK PE=3 SV=1 7 327 6.0E-10
sp|Q5P1H5|DNAK_AROAE Chaperone protein DnaK OS=Aromatoleum aromaticum (strain EbN1) GN=dnaK PE=3 SV=1 7 477 7.0E-10
sp|B7ID00|DNAK_THEAB Chaperone protein DnaK OS=Thermosipho africanus (strain TCF52B) GN=dnaK PE=3 SV=1 1 340 8.0E-10
sp|Q04EE1|DNAK_OENOB Chaperone protein DnaK OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=dnaK PE=3 SV=1 7 366 8.0E-10
sp|B8D758|DNAK_BUCAT Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaK PE=3 SV=1 7 235 1.0E-09
sp|O32464|DNAK_BUCAI Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaK PE=3 SV=1 7 235 1.0E-09
sp|B8D8V4|DNAK_BUCA5 Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaK PE=3 SV=1 7 235 1.0E-09
sp|Q9TLT1|DNAK_CYACA Chaperone protein dnaK OS=Cyanidium caldarium GN=dnaK PE=3 SV=1 7 366 1.0E-09
sp|A9VHU1|DNAK_BACWK Chaperone protein DnaK OS=Bacillus weihenstephanensis (strain KBAB4) GN=dnaK PE=3 SV=1 7 203 1.0E-09
sp|Q03QU1|DNAK_LACBA Chaperone protein DnaK OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaK PE=3 SV=1 1 203 1.0E-09
sp|A7GT08|DNAK_BACCN Chaperone protein DnaK OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaK PE=3 SV=1 7 327 1.0E-09
sp|Q4A658|DNAK_MYCS5 Chaperone protein DnaK OS=Mycoplasma synoviae (strain 53) GN=dnaK PE=3 SV=1 4 327 1.0E-09
sp|Q03WI2|DNAK_LEUMM Chaperone protein DnaK OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dnaK PE=3 SV=1 7 203 2.0E-09
sp|Q71ZJ7|DNAK_LISMF Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaK PE=3 SV=3 7 327 2.0E-09
sp|C1KVC0|DNAK_LISMC Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaK PE=3 SV=1 7 327 2.0E-09
sp|Q92BN8|DNAK_LISIN Chaperone protein DnaK OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaK PE=3 SV=3 7 327 2.0E-09
sp|Q5M6D1|DNAK_STRT2 Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dnaK PE=3 SV=1 7 354 2.0E-09
sp|P0DJM2|DNAK_LISMO Chaperone protein DnaK OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaK PE=3 SV=1 7 327 2.0E-09
sp|G2K046|DNAK_LISM4 Chaperone protein DnaK OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaK PE=3 SV=1 7 327 2.0E-09
sp|B8DE38|DNAK_LISMH Chaperone protein DnaK OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaK PE=3 SV=1 7 327 2.0E-09
sp|A7Z6W1|DNAK_BACMF Chaperone protein DnaK OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaK PE=3 SV=1 7 203 2.0E-09
sp|Q03MR6|DNAK_STRTD Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dnaK PE=3 SV=1 7 354 2.0E-09
sp|Q5M1T8|DNAK_STRT1 Chaperone protein DnaK OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dnaK PE=3 SV=1 7 354 2.0E-09
sp|Q5WHG1|DNAK_BACSK Chaperone protein DnaK OS=Bacillus clausii (strain KSM-K16) GN=dnaK PE=3 SV=1 7 203 2.0E-09
sp|B9E6X1|DNAK_MACCJ Chaperone protein DnaK OS=Macrococcus caseolyticus (strain JCSC5402) GN=dnaK PE=3 SV=1 7 203 2.0E-09
sp|P17820|DNAK_BACSU Chaperone protein DnaK OS=Bacillus subtilis (strain 168) GN=dnaK PE=1 SV=3 7 327 2.0E-09
sp|A0Q1R4|DNAK_CLONN Chaperone protein DnaK OS=Clostridium novyi (strain NT) GN=dnaK PE=3 SV=1 7 327 2.0E-09
sp|Q1WUE8|DNAK_LACS1 Chaperone protein DnaK OS=Lactobacillus salivarius (strain UCC118) GN=dnaK PE=3 SV=1 7 366 3.0E-09
sp|P26823|DNAK_CLOPE Chaperone protein DnaK OS=Clostridium perfringens (strain 13 / Type A) GN=dnaK PE=3 SV=2 7 327 3.0E-09
sp|Q0TNS7|DNAK_CLOP1 Chaperone protein DnaK OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dnaK PE=3 SV=1 7 327 3.0E-09
sp|C4Z1J4|DNAK_EUBE2 Chaperone protein DnaK OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=dnaK PE=3 SV=1 7 203 3.0E-09
sp|B8I305|DNAK_CLOCE Chaperone protein DnaK OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaK PE=3 SV=1 7 246 3.0E-09
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 7 198 3.0E-09
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 7 327 3.0E-09
sp|Q6KIH7|DNAK_MYCMO Chaperone protein DnaK OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaK PE=3 SV=1 1 203 3.0E-09
sp|C1DD88|DNAK_LARHH Chaperone protein DnaK OS=Laribacter hongkongensis (strain HLHK9) GN=dnaK PE=3 SV=1 7 366 3.0E-09
sp|Q182E8|DNAK_PEPD6 Chaperone protein DnaK OS=Peptoclostridium difficile (strain 630) GN=dnaK PE=3 SV=1 7 203 3.0E-09
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 7 255 3.0E-09
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 7 327 4.0E-09
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 7 203 4.0E-09
sp|B2U8U5|HSCA_RALPJ Chaperone protein HscA homolog OS=Ralstonia pickettii (strain 12J) GN=hscA PE=3 SV=1 4 327 4.0E-09
sp|Q98QY7|DNAK_MYCPU Chaperone protein DnaK OS=Mycoplasma pulmonis (strain UAB CTIP) GN=dnaK PE=3 SV=1 4 366 4.0E-09
sp|P59565|DNAK_BUCBP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaK PE=3 SV=1 7 340 4.0E-09
sp|Q5KWZ7|DNAK_GEOKA Chaperone protein DnaK OS=Geobacillus kaustophilus (strain HTA426) GN=dnaK PE=1 SV=1 7 327 4.0E-09
sp|B5ZBE9|DNAK_UREU1 Chaperone protein DnaK OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=dnaK PE=3 SV=1 4 198 6.0E-09
sp|B1MZG6|DNAK_LEUCK Chaperone protein DnaK OS=Leuconostoc citreum (strain KM20) GN=dnaK PE=3 SV=1 7 203 7.0E-09
sp|Q1H365|HSCA_METFK Chaperone protein HscA homolog OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hscA PE=3 SV=1 128 327 7.0E-09
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 7 327 7.0E-09
sp|Q9JUF4|HSCA_NEIMA Chaperone protein HscA homolog OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hscA PE=3 SV=1 128 364 7.0E-09
sp|Q65H54|DNAK_BACLD Chaperone protein DnaK OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaK PE=3 SV=1 7 327 7.0E-09
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 7 366 7.0E-09
sp|Q9JS04|HSCA_NEIMB Chaperone protein HscA homolog OS=Neisseria meningitidis serogroup B (strain MC58) GN=hscA PE=3 SV=1 128 338 8.0E-09
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 7 340 8.0E-09
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 91 327 9.0E-09
sp|A2BZ91|DNAK_PROM5 Chaperone protein DnaK OS=Prochlorococcus marinus (strain MIT 9515) GN=dnaK PE=3 SV=1 7 203 1.0E-08
sp|B1YKS9|DNAK_EXIS2 Chaperone protein DnaK OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dnaK PE=3 SV=1 7 203 1.0E-08
sp|Q8KML6|DNAK_LACSN Chaperone protein DnaK OS=Lactobacillus sanfranciscensis GN=dnaK PE=3 SV=1 1 203 1.0E-08
sp|Q88VM0|DNAK_LACPL Chaperone protein DnaK OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaK PE=3 SV=1 1 203 1.0E-08
sp|A4IR31|DNAK_GEOTN Chaperone protein DnaK OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaK PE=3 SV=1 7 198 1.0E-08
sp|A5IXT5|DNAK_MYCAP Chaperone protein DnaK OS=Mycoplasma agalactiae (strain PG2) GN=dnaK PE=3 SV=1 4 198 1.0E-08
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 7 327 1.0E-08
sp|A6SXE9|HSCA_JANMA Chaperone protein HscA homolog OS=Janthinobacterium sp. (strain Marseille) GN=hscA PE=3 SV=1 5 279 1.0E-08
sp|Q7V3T5|DNAK2_PROMM Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain MIT 9313) GN=dnaK2 PE=3 SV=1 7 203 2.0E-08
sp|Q67S54|DNAK_SYMTH Chaperone protein DnaK OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaK PE=3 SV=1 7 203 2.0E-08
sp|Q7UZG3|DNAK2_PROMP Chaperone protein dnaK2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaK2 PE=3 SV=1 7 327 2.0E-08
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 7 327 2.0E-08
sp|Q2Y6U0|DNAK_NITMU Chaperone protein DnaK OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dnaK PE=3 SV=1 7 461 2.0E-08
sp|Q03FR7|DNAK_PEDPA Chaperone protein DnaK OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaK PE=3 SV=1 1 203 2.0E-08
sp|Q835R7|DNAK_ENTFA Chaperone protein DnaK OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaK PE=3 SV=1 7 198 2.0E-08
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 7 366 2.0E-08
sp|A4SYY9|HSCA_POLSQ Chaperone protein HscA homolog OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=hscA PE=3 SV=1 4 364 2.0E-08
sp|Q05FS8|DNAK_CARRP Chaperone protein DnaK OS=Carsonella ruddii (strain PV) GN=dnaK PE=3 SV=1 7 207 3.0E-08
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 91 327 3.0E-08
sp|Q5NYT1|HSCA_AROAE Chaperone protein HscA homolog OS=Aromatoleum aromaticum (strain EbN1) GN=hscA PE=3 SV=1 128 340 3.0E-08
sp|Q7V9G2|DNAK2_PROMA Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK2 PE=3 SV=1 7 366 3.0E-08
sp|Q892R0|DNAK_CLOTE Chaperone protein DnaK OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaK PE=3 SV=1 7 327 4.0E-08
sp|A4VT29|DNAK_STRSY Chaperone protein DnaK OS=Streptococcus suis (strain 05ZYH33) GN=dnaK PE=3 SV=1 7 203 4.0E-08
sp|A4VZB5|DNAK_STRS2 Chaperone protein DnaK OS=Streptococcus suis (strain 98HAH33) GN=dnaK PE=3 SV=1 7 203 4.0E-08
sp|A8AVA8|DNAK_STRGC Chaperone protein DnaK OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dnaK PE=3 SV=1 7 203 4.0E-08
sp|P64409|DNAK_TROWT Chaperone protein DnaK OS=Tropheryma whipplei (strain Twist) GN=dnaK PE=3 SV=1 8 327 4.0E-08
sp|P64410|DNAK_TROW8 Chaperone protein DnaK OS=Tropheryma whipplei (strain TW08/27) GN=dnaK PE=3 SV=1 8 327 4.0E-08
sp|Q3YRR6|DNAK_EHRCJ Chaperone protein DnaK OS=Ehrlichia canis (strain Jake) GN=dnaK PE=3 SV=1 7 340 5.0E-08
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 7 327 5.0E-08
sp|B1VMF3|DNAK_STRGG Chaperone protein DnaK OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=dnaK PE=3 SV=1 8 327 5.0E-08
sp|C1CQ18|DNAK_STRZT Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dnaK PE=3 SV=1 7 203 5.0E-08
sp|C1CJ06|DNAK_STRZP Chaperone protein DnaK OS=Streptococcus pneumoniae (strain P1031) GN=dnaK PE=3 SV=1 7 203 5.0E-08
sp|Q8CWT3|DNAK_STRR6 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dnaK PE=3 SV=1 7 203 5.0E-08
sp|B1IA52|DNAK_STRPI Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dnaK PE=3 SV=1 7 203 5.0E-08
sp|C1C5N7|DNAK_STRP7 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain 70585) GN=dnaK PE=3 SV=1 7 203 5.0E-08
sp|Q04LY0|DNAK_STRP2 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dnaK PE=3 SV=1 7 203 5.0E-08
sp|B2IMB5|DNAK_STRPS Chaperone protein DnaK OS=Streptococcus pneumoniae (strain CGSP14) GN=dnaK PE=3 SV=1 7 203 5.0E-08
sp|Q9ZEJ0|DNAK_MYCHO Chaperone protein DnaK OS=Mycoplasma hominis GN=dnaK PE=3 SV=1 4 327 5.0E-08
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 91 327 5.0E-08
sp|C1CCQ8|DNAK_STRZJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain JJA) GN=dnaK PE=3 SV=1 7 203 5.0E-08
sp|P95829|DNAK_STRPN Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dnaK PE=3 SV=2 7 203 5.0E-08
sp|B8ZLY9|DNAK_STRPJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dnaK PE=3 SV=1 7 203 5.0E-08
sp|Q5F8E8|HSCA_NEIG1 Chaperone protein HscA homolog OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hscA PE=3 SV=1 128 364 6.0E-08
sp|Q46I76|DNAK_PROMT Chaperone protein DnaK OS=Prochlorococcus marinus (strain NATL2A) GN=dnaK PE=3 SV=1 7 203 6.0E-08
sp|Q54215|DNAK_STRGR Chaperone protein DnaK OS=Streptomyces griseus GN=dnaK PE=3 SV=1 8 327 6.0E-08
sp|O06942|DNAK_STRMU Chaperone protein DnaK OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaK PE=2 SV=2 7 203 6.0E-08
sp|Q74IT6|DNAK_LACJO Chaperone protein DnaK OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaK PE=3 SV=1 7 198 6.0E-08
sp|B5XHZ0|DNAK_STRPZ Chaperone protein DnaK OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dnaK PE=3 SV=1 7 203 6.0E-08
sp|P0C0C5|DNAK_STRPY Chaperone protein DnaK OS=Streptococcus pyogenes GN=dnaK PE=3 SV=2 7 203 6.0E-08
sp|Q48RR3|DNAK_STRPM Chaperone protein DnaK OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dnaK PE=3 SV=1 7 203 6.0E-08
sp|A2RCW6|DNAK_STRPG Chaperone protein DnaK OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dnaK PE=3 SV=1 7 203 6.0E-08
sp|Q1J578|DNAK_STRPF Chaperone protein DnaK OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dnaK PE=3 SV=1 7 203 6.0E-08
sp|P68837|DNAK_STRP8 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dnaK PE=3 SV=2 7 203 6.0E-08
sp|Q5XAD6|DNAK_STRP6 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dnaK PE=1 SV=3 7 203 6.0E-08
sp|P0C0C6|DNAK_STRP1 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M1 GN=dnaK PE=3 SV=2 7 203 6.0E-08
sp|Q044A9|DNAK_LACGA Chaperone protein DnaK OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaK PE=3 SV=1 7 198 7.0E-08
sp|B5E232|DNAK_STRP4 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dnaK PE=3 SV=1 7 203 8.0E-08
sp|A2VD93|HS7EB_XENLA Heat shock 70 kDa protein 14-B OS=Xenopus laevis GN=hspa14-b PE=2 SV=1 113 343 8.0E-08
sp|C0ME86|DNAK_STRS7 Chaperone protein DnaK OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=dnaK PE=3 SV=1 7 203 8.0E-08
sp|C0M7T9|DNAK_STRE4 Chaperone protein DnaK OS=Streptococcus equi subsp. equi (strain 4047) GN=dnaK PE=3 SV=1 7 203 8.0E-08
sp|Q12WE6|DNAK_METBU Chaperone protein DnaK OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=dnaK PE=3 SV=1 7 327 8.0E-08
sp|B2GGP0|DNAK_KOCRD Chaperone protein DnaK OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=dnaK PE=3 SV=1 8 364 9.0E-08
sp|B0RBI1|DNAK_CLAMS Chaperone protein DnaK OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=dnaK PE=3 SV=1 8 327 9.0E-08
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 7 327 9.0E-08
sp|B2HZI1|HSCA_ACIBC Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain ACICU) GN=hscA PE=3 SV=1 5 340 9.0E-08
sp|Q21X09|DNAK_RHOFT Chaperone protein DnaK OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=dnaK PE=3 SV=1 7 366 9.0E-08
sp|A5CM86|DNAK_CLAM3 Chaperone protein DnaK OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=dnaK PE=3 SV=1 8 327 9.0E-08
sp|B1HUD1|DNAK_LYSSC Chaperone protein DnaK OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaK PE=3 SV=1 7 203 9.0E-08
sp|Q95YL7|HSP70_ENCHE Mitochondrial-type heat shock protein 70 OS=Encephalitozoon hellem GN=HSP70 PE=3 SV=1 7 366 1.0E-07
sp|B0VD55|HSCA_ACIBY Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain AYE) GN=hscA PE=3 SV=1 5 340 1.0E-07
sp|B7I5P9|HSCA_ACIB5 Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain AB0057) GN=hscA PE=3 SV=1 5 340 1.0E-07
sp|B7H3H4|HSCA_ACIB3 Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain AB307-0294) GN=hscA PE=3 SV=1 5 340 1.0E-07
sp|O69268|DNAK_LYSSH Chaperone protein DnaK OS=Lysinibacillus sphaericus GN=dnaK PE=3 SV=3 7 203 1.0E-07
sp|Q7VC04|DNAK1_PROMA Chaperone protein dnaK1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK1 PE=3 SV=1 7 364 1.0E-07
sp|B9DVF3|DNAK_STRU0 Chaperone protein DnaK OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dnaK PE=3 SV=1 7 198 1.0E-07
sp|Q5FVX7|HSP7E_XENTR Heat shock 70 kDa protein 14 OS=Xenopus tropicalis GN=hspa14 PE=2 SV=1 113 343 1.0E-07
sp|A0LWS7|DNAK_ACIC1 Chaperone protein DnaK OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=dnaK PE=3 SV=1 8 203 1.0E-07
sp|A3M561|HSCA_ACIBT Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hscA PE=3 SV=2 5 340 1.0E-07
sp|P75344|DNAK_MYCPN Chaperone protein DnaK OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaK PE=3 SV=1 3 198 1.0E-07
sp|Q7U3C4|DNAK2_SYNPX Chaperone protein dnaK2 OS=Synechococcus sp. (strain WH8102) GN=dnaK2 PE=3 SV=1 7 203 1.0E-07
sp|Q93R27|DNAK_TETHA Chaperone protein DnaK OS=Tetragenococcus halophilus GN=dnaK PE=3 SV=1 7 327 1.0E-07
sp|Q1JFC8|DNAK_STRPD Chaperone protein DnaK OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dnaK PE=3 SV=1 7 203 1.0E-07
sp|A3CQC2|DNAK_STRSV Chaperone protein DnaK OS=Streptococcus sanguinis (strain SK36) GN=dnaK PE=3 SV=1 7 203 1.0E-07
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 7 327 2.0E-07
sp|P0DB71|DNAK_STRPQ Chaperone protein DnaK OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dnaK PE=3 SV=1 7 203 2.0E-07
sp|P0DB70|DNAK_STRP3 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dnaK PE=3 SV=1 7 203 2.0E-07
sp|B3R6G7|DNAK_CUPTR Chaperone protein DnaK OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaK PE=3 SV=1 7 366 2.0E-07
sp|Q9K0N4|DNAK_NEIMB Chaperone protein DnaK OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaK PE=1 SV=1 7 366 2.0E-07
sp|Q1JKD6|DNAK_STRPC Chaperone protein DnaK OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dnaK PE=3 SV=1 7 203 2.0E-07
sp|Q1JA83|DNAK_STRPB Chaperone protein DnaK OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=dnaK PE=3 SV=1 7 203 2.0E-07
sp|P0A3J4|DNAK_STRAG Chaperone protein DnaK OS=Streptococcus agalactiae GN=dnaK PE=3 SV=1 7 203 2.0E-07
sp|P0A3J3|DNAK_STRA5 Chaperone protein DnaK OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dnaK PE=3 SV=1 7 203 2.0E-07
sp|P0A3J2|DNAK_STRA3 Chaperone protein DnaK OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dnaK PE=3 SV=1 7 203 2.0E-07
sp|Q3K3T2|DNAK_STRA1 Chaperone protein DnaK OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dnaK PE=3 SV=1 7 203 2.0E-07
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 7 340 2.0E-07
sp|B1H009|DNAK_UNCTG Chaperone protein DnaK OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=dnaK PE=3 SV=1 7 255 2.0E-07
sp|Q0K757|DNAK_CUPNH Chaperone protein DnaK OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaK PE=3 SV=1 7 366 2.0E-07
sp|Q6D263|HSCA_PECAS Chaperone protein HscA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hscA PE=3 SV=1 4 327 2.0E-07
sp|Q6FCE6|HSCA_ACIAD Chaperone protein HscA homolog OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hscA PE=3 SV=1 128 340 2.0E-07
sp|A9M296|DNAK_NEIM0 Chaperone protein DnaK OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaK PE=3 SV=1 7 366 2.0E-07
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 7 204 3.0E-07
sp|B3WEQ7|DNAK_LACCB Chaperone protein DnaK OS=Lactobacillus casei (strain BL23) GN=dnaK PE=3 SV=1 7 198 3.0E-07
sp|Q038N3|DNAK_LACC3 Chaperone protein DnaK OS=Lactobacillus casei (strain ATCC 334) GN=dnaK PE=3 SV=1 7 198 3.0E-07
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 91 327 3.0E-07
sp|B0VNV8|HSCA_ACIBS Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain SDF) GN=hscA PE=3 SV=1 128 340 3.0E-07
sp|B6IZJ0|DNAK_COXB2 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaK PE=3 SV=1 7 477 3.0E-07
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 7 327 3.0E-07
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 7 327 3.0E-07
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 7 327 4.0E-07
sp|Q5RGE6|HSP7E_DANRE Heat shock 70 kDa protein 14 OS=Danio rerio GN=hspa14 PE=2 SV=1 113 343 4.0E-07
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 3 327 4.0E-07
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 7 327 4.0E-07
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 126 340 4.0E-07
sp|O87712|DNAK_COXBU Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaK PE=1 SV=1 7 477 4.0E-07
sp|A9N8H2|DNAK_COXBR Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaK PE=3 SV=1 7 477 4.0E-07
sp|A9KG88|DNAK_COXBN Chaperone protein DnaK OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaK PE=3 SV=1 7 477 4.0E-07
sp|B6J7U7|DNAK_COXB1 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaK PE=3 SV=1 7 477 4.0E-07
sp|Q84BU4|DNAK_LACAC Chaperone protein DnaK OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaK PE=3 SV=1 7 366 4.0E-07
sp|Q9L7Z1|DNAK_VIBPR Chaperone protein DnaK OS=Vibrio proteolyticus GN=dnaK PE=3 SV=1 128 366 4.0E-07
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 7 327 4.0E-07
sp|P57870|DNAK_PASMU Chaperone protein DnaK OS=Pasteurella multocida (strain Pm70) GN=dnaK PE=3 SV=1 7 327 5.0E-07
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 113 327 5.0E-07
sp|B8DT62|DNAK_BIFA0 Chaperone protein DnaK OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dnaK PE=3 SV=1 8 364 5.0E-07
sp|Q1MPW1|DNAK_LAWIP Chaperone protein DnaK OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=dnaK PE=3 SV=1 83 340 5.0E-07
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 91 327 5.0E-07
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 91 327 5.0E-07
sp|Q0RBC4|DNAK_FRAAA Chaperone protein DnaK OS=Frankia alni (strain ACN14a) GN=dnaK PE=3 SV=1 8 203 5.0E-07
sp|O87777|DNAK_LACSK Chaperone protein DnaK OS=Lactobacillus sakei GN=dnaK PE=2 SV=1 7 203 5.0E-07
sp|Q38W93|DNAK_LACSS Chaperone protein DnaK OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaK PE=3 SV=1 7 203 6.0E-07
sp|A8YVQ3|DNAK_LACH4 Chaperone protein DnaK OS=Lactobacillus helveticus (strain DPC 4571) GN=dnaK PE=3 SV=1 7 366 6.0E-07
sp|Q01PM8|DNAK_SOLUE Chaperone protein DnaK OS=Solibacter usitatus (strain Ellin6076) GN=dnaK PE=3 SV=1 7 203 7.0E-07
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 79 328 7.0E-07
sp|A0RPW7|DNAK_CAMFF Chaperone protein DnaK OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=dnaK PE=3 SV=1 83 366 7.0E-07
sp|Q6G1F9|DNAK_BARQU Chaperone protein DnaK OS=Bartonella quintana (strain Toulouse) GN=dnaK PE=3 SV=1 79 328 7.0E-07
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 7 340 7.0E-07
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 7 340 7.0E-07
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 7 340 8.0E-07
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 113 327 8.0E-07
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 7 340 8.0E-07
sp|A8H760|DNAK_SHEPA Chaperone protein DnaK OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaK PE=3 SV=1 126 364 8.0E-07
sp|A1VMG2|DNAK_POLNA Chaperone protein DnaK OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaK PE=3 SV=1 7 366 9.0E-07
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 7 340 9.0E-07
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 7 340 9.0E-07
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 7 342 9.0E-07
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 7 340 9.0E-07
sp|C3LTA5|DNAK_VIBCM Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaK PE=3 SV=1 128 340 9.0E-07
sp|O34241|DNAK_VIBCH Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaK PE=3 SV=2 128 340 9.0E-07
sp|A5F361|DNAK_VIBC3 Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaK PE=3 SV=1 128 340 9.0E-07
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 79 328 9.0E-07
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 43 328 1.0E-06
sp|B0TQC2|DNAK_SHEHH Chaperone protein DnaK OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaK PE=3 SV=1 126 364 1.0E-06
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 8 327 1.0E-06
sp|B7GT47|DNAK_BIFLS Chaperone protein DnaK OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=dnaK PE=3 SV=1 8 364 1.0E-06
sp|Q9JVQ9|DNAK_NEIMA Chaperone protein DnaK OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaK PE=3 SV=1 7 366 1.0E-06
sp|Q6F6N3|DNAK_ACIAD Chaperone protein DnaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaK PE=3 SV=1 7 366 1.0E-06
sp|Q7MA35|DNAK_WOLSU Chaperone protein DnaK OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaK PE=3 SV=1 91 366 1.0E-06
sp|Q2KWA2|DNAK_BORA1 Chaperone protein DnaK OS=Bordetella avium (strain 197N) GN=dnaK PE=3 SV=1 126 366 1.0E-06
sp|A3QGW2|DNAK_SHELP Chaperone protein DnaK OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaK PE=3 SV=1 7 364 1.0E-06
sp|Q0AKB1|DNAK_MARMM Chaperone protein DnaK OS=Maricaulis maris (strain MCS10) GN=dnaK PE=3 SV=1 7 203 2.0E-06
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 7 340 2.0E-06
sp|B8GNX1|DNAK_THISH Chaperone protein DnaK OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaK PE=3 SV=1 7 364 2.0E-06
sp|A9BWU9|HSCA_DELAS Chaperone protein HscA homolog OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=hscA PE=3 SV=1 4 342 2.0E-06
sp|Q8G6W1|DNAK_BIFLO Chaperone protein DnaK OS=Bifidobacterium longum (strain NCC 2705) GN=dnaK PE=3 SV=1 8 364 2.0E-06
sp|B3DNP9|DNAK_BIFLD Chaperone protein DnaK OS=Bifidobacterium longum (strain DJO10A) GN=dnaK PE=3 SV=1 8 364 2.0E-06
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 8 327 2.0E-06
sp|A4G782|HSCA_HERAR Chaperone protein HscA homolog OS=Herminiimonas arsenicoxydans GN=hscA PE=3 SV=1 5 205 2.0E-06
sp|Q5F6W5|DNAK_NEIG1 Chaperone protein DnaK OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaK PE=3 SV=1 7 366 2.0E-06
sp|Q473J2|HSCA_CUPPJ Chaperone protein HscA homolog OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hscA PE=3 SV=1 4 327 2.0E-06
sp|P20030|HSP7C_TRYBB Heat shock cognate HSP70 protein OS=Trypanosoma brucei brucei PE=3 SV=1 8 340 2.0E-06
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 7 340 2.0E-06
sp|A1A3P5|DNAK_BIFAA Chaperone protein DnaK OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=dnaK PE=3 SV=1 8 364 2.0E-06
sp|Q87RX3|DNAK_VIBPA Chaperone protein DnaK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaK PE=3 SV=1 128 366 2.0E-06
sp|Q486F9|DNAK1_COLP3 Chaperone protein DnaK 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaK1 PE=3 SV=1 7 207 2.0E-06
sp|C1CZH9|DNAK_DEIDV Chaperone protein DnaK OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=dnaK PE=3 SV=1 8 203 2.0E-06
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 3 327 2.0E-06
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|Q6MB26|DNAK_PARUW Chaperone protein DnaK OS=Protochlamydia amoebophila (strain UWE25) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|B8IHL3|DNAK_METNO Chaperone protein DnaK OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaK PE=3 SV=1 7 328 3.0E-06
sp|A1KSG3|DNAK_NEIMF Chaperone protein DnaK OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|Q7NZ33|HSCA_CHRVO Chaperone protein HscA homolog OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hscA PE=3 SV=1 128 340 3.0E-06
sp|P94695|DNAK_DEIPM Chaperone protein DnaK OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaK PE=3 SV=2 8 203 3.0E-06
sp|Q3Z601|DNAK_SHISS Chaperone protein DnaK OS=Shigella sonnei (strain Ss046) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|Q32KA5|DNAK_SHIDS Chaperone protein DnaK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|Q326K7|DNAK_SHIBS Chaperone protein DnaK OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|Q1RGI8|DNAK_ECOUT Chaperone protein DnaK OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|P0A6Y8|DNAK_ECOLI Chaperone protein DnaK OS=Escherichia coli (strain K12) GN=dnaK PE=1 SV=2 7 366 3.0E-06
sp|B1IRG0|DNAK_ECOLC Chaperone protein DnaK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|P0A6Y9|DNAK_ECOL6 Chaperone protein DnaK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaK PE=3 SV=2 7 366 3.0E-06
sp|Q0TLX5|DNAK_ECOL5 Chaperone protein DnaK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|A1A766|DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|P0A6Z0|DNAK_ECO57 Chaperone protein DnaK OS=Escherichia coli O157:H7 GN=dnaK PE=3 SV=2 7 366 3.0E-06
sp|A7ZHA4|DNAK_ECO24 Chaperone protein DnaK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaK PE=3 SV=1 7 366 3.0E-06
sp|Q9LDZ0|HSP7J_ARATH Heat shock 70 kDa protein 10, mitochondrial OS=Arabidopsis thaliana GN=HSP70-10 PE=2 SV=1 7 366 4.0E-06
sp|A7ZVV7|DNAK_ECOHS Chaperone protein DnaK OS=Escherichia coli O9:H4 (strain HS) GN=dnaK PE=3 SV=1 7 366 4.0E-06
sp|O87384|DNAK_VIBHA Chaperone protein DnaK OS=Vibrio harveyi GN=dnaK PE=3 SV=1 7 366 4.0E-06
sp|B2JGE2|DNAK_BURP8 Chaperone protein DnaK OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaK PE=3 SV=1 7 340 5.0E-06
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 7 340 5.0E-06
sp|A8FYU0|DNAK_SHESH Chaperone protein DnaK OS=Shewanella sediminis (strain HAW-EB3) GN=dnaK PE=3 SV=1 7 364 5.0E-06
sp|B2FMY5|DNAK_STRMK Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaK PE=3 SV=1 7 207 6.0E-06
sp|B4SSQ6|DNAK_STRM5 Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaK PE=3 SV=1 7 366 6.0E-06
sp|Q83MH5|DNAK_SHIFL Chaperone protein DnaK OS=Shigella flexneri GN=dnaK PE=3 SV=1 7 366 6.0E-06
sp|Q0T8H6|DNAK_SHIF8 Chaperone protein DnaK OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaK PE=3 SV=1 7 366 6.0E-06
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 91 327 6.0E-06
sp|Q08276|HSP7M_SOLTU Heat shock 70 kDa protein, mitochondrial OS=Solanum tuberosum GN=HSP68 PE=2 SV=1 7 366 7.0E-06
sp|P95334|DNAK_MYXXD Chaperone protein DnaK OS=Myxococcus xanthus (strain DK 1622) GN=dnaK PE=3 SV=2 7 340 7.0E-06
sp|A1K724|HSCA_AZOSB Chaperone protein HscA homolog OS=Azoarcus sp. (strain BH72) GN=hscA PE=3 SV=1 5 340 7.0E-06
sp|Q97BG8|DNAK_THEVO Chaperone protein DnaK OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaK PE=3 SV=1 7 211 8.0E-06
sp|O86103|DNAK_AQUPY Chaperone protein DnaK (Fragment) OS=Aquifex pyrophilus GN=dnaK PE=3 SV=1 64 340 8.0E-06
sp|Q5E4T4|DNAK1_VIBF1 Chaperone protein DnaK 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaK1 PE=3 SV=1 128 366 9.0E-06
sp|Q1IWL4|DNAK_DEIGD Chaperone protein DnaK OS=Deinococcus geothermalis (strain DSM 11300) GN=dnaK PE=3 SV=1 8 203 9.0E-06
sp|A7MWW0|DNAK_VIBCB Chaperone protein DnaK OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaK PE=3 SV=1 128 366 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0140657 ATP-dependent activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0030554 adenyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0044183 protein folding chaperone No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6076
MADRRIIVSIDFGTTYSGVAWAETSRPDVQHVISSWPSASSFKSSPKVPTELRRVASGWQWGFQIPETAKRYRFF
KLKLDEPGRAYKDNESPQELTRIYLSCLHTHFIGVLEKRLSPSVVRSTPMEFVVTVPAIWSNAAKQATERAAAMA
GFCGNQRIQLISEPEAAALYTLKQLSPSILQRGRKFVVCDAGGGTVDLISYEVTRVEKLEVKEVTEGTGGRCGSS
MLNKRFRRFLKQTHGEKPWTDEQLITALNEFELFKKDFSPKGEPLTIRVDESLGLRRNRFTIPQEEMASRIFEPI
IKDVVCLIGEQISMAGNDIAAVVLVGGFGQSRHLKSKVREAVPAGVKVLQPENGWIAVVKGAAIFGLGQCQPMLA
EVEVASRVARRSYGTCLLAKYDMMRHDAREAFWSQKEGEMVTTEMCWFIQKGQSYPEGKPSSIEYQCDIPVSMGH
VPQTEIEIFSNEEDAKPPTHVNSRTRCVATLSLDLDRIPNAVKLAAGKTRMGWHRYYCLSGVIEASYGSAMITYS
VKLGGVTHDAITVRYED
Coding >Ophio5|6076
ATGGCCGACAGGAGAATCATCGTCTCCATAGACTTTGGAACGACCTACTCCGGCGTCGCCTGGGCCGAGACTTCA
AGGCCCGACGTGCAGCATGTGATATCGAGCTGGCCGTCGGCGAGCTCTTTCAAGAGCAGTCCCAAGGTGCCGACC
GAACTGCGCAGGGTCGCCTCTGGCTGGCAATGGGGCTTTCAGATCCCAGAAACGGCTAAACGATATCGATTCTTC
AAACTGAAGCTAGACGAGCCGGGAAGGGCATACAAGGACAATGAGTCTCCTCAGGAGCTCACCAGGATTTATCTT
TCCTGTCTTCACACGCACTTCATCGGCGTCCTCGAGAAGCGGTTGTCGCCCAGCGTCGTGCGTTCGACGCCCATG
GAGTTTGTCGTCACCGTCCCGGCCATATGGTCCAACGCGGCCAAGCAGGCCACCGAGCGGGCCGCCGCCATGGCC
GGATTCTGCGGAAATCAGCGTATCCAGCTTATATCAGAACCAGAAGCGGCGGCGCTGTATACCCTGAAGCAACTC
AGCCCTTCTATCCTGCAACGCGGCCGCAAATTCGTCGTGTGCGACGCCGGCGGCGGGACCGTAGACCTCATCTCC
TACGAAGTCACCCGGGTAGAGAAGCTAGAGGTCAAGGAAGTGACCGAGGGCACGGGCGGTAGGTGCGGCTCGTCC
ATGCTCAATAAGAGATTTCGCCGCTTCCTGAAGCAAACACACGGGGAGAAGCCATGGACGGACGAGCAGCTGATT
ACTGCCCTGAATGAGTTTGAGTTGTTCAAGAAGGACTTTTCCCCAAAGGGCGAGCCGCTGACGATACGGGTCGAC
GAGAGTCTCGGGCTCAGACGTAACCGGTTTACCATACCGCAAGAGGAGATGGCGTCTCGGATCTTCGAACCCATC
ATCAAGGACGTCGTTTGCCTCATCGGAGAACAAATTTCCATGGCGGGCAATGACATCGCCGCCGTCGTCCTCGTC
GGCGGGTTCGGGCAGAGCCGGCATCTCAAGTCCAAGGTCCGGGAGGCTGTTCCGGCCGGCGTCAAGGTTCTACAG
CCCGAGAACGGCTGGATCGCGGTCGTCAAGGGAGCTGCCATATTTGGACTCGGCCAGTGTCAACCGATGCTGGCC
GAGGTAGAGGTTGCGTCTCGCGTGGCGCGGAGATCGTACGGCACATGTCTGCTGGCCAAGTACGACATGATGAGA
CACGACGCCAGGGAAGCCTTCTGGTCCCAGAAAGAAGGGGAGATGGTGACGACAGAAATGTGCTGGTTCATCCAA
AAGGGTCAATCCTATCCAGAGGGAAAGCCTTCCTCCATCGAGTACCAATGCGATATCCCCGTTAGCATGGGCCAC
GTGCCGCAAACGGAAATCGAGATATTCAGTAATGAAGAGGACGCAAAACCGCCGACCCACGTCAACTCCAGGACG
CGCTGCGTTGCGACGCTCTCCCTCGACCTGGATAGAATCCCCAATGCGGTGAAGCTAGCGGCCGGGAAGACGAGG
ATGGGGTGGCACCGTTATTATTGTCTGAGCGGCGTGATCGAGGCGAGCTACGGATCAGCCATGATAACATACTCG
GTCAAGCTCGGAGGGGTGACACACGATGCCATCACGGTCAGATACGAGGAT
Transcript >Ophio5|6076
ATGGCCGACAGGAGAATCATCGTCTCCATAGACTTTGGAACGACCTACTCCGGCGTCGCCTGGGCCGAGACTTCA
AGGCCCGACGTGCAGCATGTGATATCGAGCTGGCCGTCGGCGAGCTCTTTCAAGAGCAGTCCCAAGGTGCCGACC
GAACTGCGCAGGGTCGCCTCTGGCTGGCAATGGGGCTTTCAGATCCCAGAAACGGCTAAACGATATCGATTCTTC
AAACTGAAGCTAGACGAGCCGGGAAGGGCATACAAGGACAATGAGTCTCCTCAGGAGCTCACCAGGATTTATCTT
TCCTGTCTTCACACGCACTTCATCGGCGTCCTCGAGAAGCGGTTGTCGCCCAGCGTCGTGCGTTCGACGCCCATG
GAGTTTGTCGTCACCGTCCCGGCCATATGGTCCAACGCGGCCAAGCAGGCCACCGAGCGGGCCGCCGCCATGGCC
GGATTCTGCGGAAATCAGCGTATCCAGCTTATATCAGAACCAGAAGCGGCGGCGCTGTATACCCTGAAGCAACTC
AGCCCTTCTATCCTGCAACGCGGCCGCAAATTCGTCGTGTGCGACGCCGGCGGCGGGACCGTAGACCTCATCTCC
TACGAAGTCACCCGGGTAGAGAAGCTAGAGGTCAAGGAAGTGACCGAGGGCACGGGCGGTAGGTGCGGCTCGTCC
ATGCTCAATAAGAGATTTCGCCGCTTCCTGAAGCAAACACACGGGGAGAAGCCATGGACGGACGAGCAGCTGATT
ACTGCCCTGAATGAGTTTGAGTTGTTCAAGAAGGACTTTTCCCCAAAGGGCGAGCCGCTGACGATACGGGTCGAC
GAGAGTCTCGGGCTCAGACGTAACCGGTTTACCATACCGCAAGAGGAGATGGCGTCTCGGATCTTCGAACCCATC
ATCAAGGACGTCGTTTGCCTCATCGGAGAACAAATTTCCATGGCGGGCAATGACATCGCCGCCGTCGTCCTCGTC
GGCGGGTTCGGGCAGAGCCGGCATCTCAAGTCCAAGGTCCGGGAGGCTGTTCCGGCCGGCGTCAAGGTTCTACAG
CCCGAGAACGGCTGGATCGCGGTCGTCAAGGGAGCTGCCATATTTGGACTCGGCCAGTGTCAACCGATGCTGGCC
GAGGTAGAGGTTGCGTCTCGCGTGGCGCGGAGATCGTACGGCACATGTCTGCTGGCCAAGTACGACATGATGAGA
CACGACGCCAGGGAAGCCTTCTGGTCCCAGAAAGAAGGGGAGATGGTGACGACAGAAATGTGCTGGTTCATCCAA
AAGGGTCAATCCTATCCAGAGGGAAAGCCTTCCTCCATCGAGTACCAATGCGATATCCCCGTTAGCATGGGCCAC
GTGCCGCAAACGGAAATCGAGATATTCAGTAATGAAGAGGACGCAAAACCGCCGACCCACGTCAACTCCAGGACG
CGCTGCGTTGCGACGCTCTCCCTCGACCTGGATAGAATCCCCAATGCGGTGAAGCTAGCGGCCGGGAAGACGAGG
ATGGGGTGGCACCGTTATTATTGTCTGAGCGGCGTGATCGAGGCGAGCTACGGATCAGCCATGATAACATACTCG
GTCAAGCTCGGAGGGGTGACACACGATGCCATCACGGTCAGATACGAGGATTAG
Gene >Ophio5|6076
ATGGCCGACAGGAGAATCATCGTCTCCATAGACTTTGGAACGACCTACTCCGGCGTCGCCTGGGCCGAGACTTCA
AGGGTATGGTTACCGTCGTCGACGATGCAGCCCAGCTAAAAAAAGCCTTGCAGCCCGACGTGCAGCATGTGATAT
CGAGCTGGCCGTCGGCGAGCTCTTTCAAGAGCAGTCCCAAGGTGCCGACCGAACTGCGCAGGGTCGCCTCTGGCT
GGCAATGGGGCTTTCAGATCCCAGAAACGGCTAAACGATATCGATTCTTCAAACTGTTAGCCCCTGGCATCCGTC
CGACTCGGGTGCGAATCCCTCGTTAAAAGACTGTCACAGGAAGCTAGACGAGCCGGGAAGGGCATACAAGGACAA
TGAGTCTCCTCAGGAGCTCACCAGGATTTATCTTTCCTGTCTTCACACGCACTTCATCGGCGTCCTCGAGAAGCG
GTTGTCGCCCAGCGTCGTGCGTTCGACGCCCATGGAGTTTGTCGTCACCGTCCCGGCCATATGGTCCAACGCGGC
CAAGCAGGCCACCGAGCGGGCCGCCGCCATGGCCGGATTCTGCGGAAATCAGCGTATCCAGCTTATATCAGAACC
AGTGCGTCCTCCCGTCTCCGTGAAGCCCAGTCGATGTTGACGCTGTCCAGGAAGCGGCGGCGCTGTATACCCTGA
AGCAACTCAGCCCTTCTATCCTGCAACGCGGCCGCAAATTCGTCGTGTGCGACGCCGGCGGCGGGACCGTAGACC
TCATCTCCTACGAAGTCACCCGGGTAGAGAAGCTAGAGGTCAAGGAAGTGACCGAGGGCACGGGCGGTAGGTGCG
GCTCGTCCATGCTCAATAAGAGATTTCGCCGCTTCCTGAAGCAAACACACGGGGAGAAGCCATGGACGGACGAGC
AGCTGATTACTGCCCTGAATGAGTTTGAGTTGGTGCGTCGACAACCAACCGCATCCGGGACACGGCTTTTGACGT
AGACACAGTTCAAGAAGGACTTTTCCCCAAAGGGCGAGCCGCTGACGATACGGGTCGACGAGAGTCTCGGGCTCA
GACGTAACCGGTTTACCATACCGCAAGAGGAGATGGCGTCTCGGATCTTCGAACCCATCATCAAGGACGTCGTTT
GCCTCATCGGAGAACAAATTTCCATGGCGGGCAATGACATCGCCGCCGTCGTCCTCGTCGGCGGGTTCGGGCAGA
GCCGGCATCTCAAGTCCAAGGTCCGGGAGGCTGTTCCGGCCGGCGTCAAGGTTCTACAGCCCGAGAACGGCTGGA
TCGCGGTCGTCAAGGGAGCTGCCATATTTGGACTCGGCCAGTGTCAACCGATGCTGGCCGAGGTAGAGGTTGCGT
CTCGCGTGGCGCGGAGATCGTACGGCACATGTCTGCTGGCCAAGTACGACATGATGAGACACGACGCCAGGGAAG
CGTGAGTCGTGGCAGCGCCAACAGGTCCAACTCGATAGGCTGACAGTCGCCTGCAGCTTCTGGTCCCAGAAAGAA
GGGGAGATGGTGACGACAGAAATGTGCTGGTTCATCCAAAAGGTAACCGGCATCGCCAATTTCCCGGCGCAAGCC
GCTGACGCCGAGCAGGGTCAATCCTATCCAGAGGGAAAGCCTTCCTCCATCGAGTACCAATGCGATATCCCCGTT
AGCATGGGCCACGTGCCGCAAACGGAAATCGAGATATTCAGTAATGAAGAGGACGCAAAACCGCCGACCCACGTC
AACTCCAGGACGCGCTGCGTTGCGACGCTCTCCCTCGACCTGGATAGAATCCCCAATGCGGTGAAGCTAGCGGCC
GGGAAGACGAGGATGGGGTGGCACCGTTATTATTGTCTGAGCGGCGTGATCGAGGCGAGCTACGGATCAGCCATG
ATAACATACTCGGTCAAGCTCGGAGGTAAGTCGAGTCGAGTCGTCATAGGTAGGATTGTAACTAACGACGCGCGC
AGGGGTGACACACGATGCCATCACGGTCAGATACGAGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail