Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6062
Gene name
Locationscaffold_512:12528..14266
Strand+
Gene length (bp)1738
Transcript length (bp)1455
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 4.7E-44 111 366
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.5E-10 387 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 85 473 4.0E-81
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 92 466 1.0E-57
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 92 466 1.0E-56
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 92 468 4.0E-55
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 130 463 3.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 85 473 4.0E-81
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 92 466 1.0E-57
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 92 466 1.0E-56
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 92 468 4.0E-55
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 130 463 3.0E-50
sp|Q8HXI3|S38AB_MACFA Putative sodium-coupled neutral amino acid transporter 11 OS=Macaca fascicularis GN=SLC38A11 PE=2 SV=1 90 466 3.0E-44
sp|Q08AI6|S38AB_HUMAN Putative sodium-coupled neutral amino acid transporter 11 OS=Homo sapiens GN=SLC38A11 PE=2 SV=1 137 466 9.0E-42
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 84 462 4.0E-24
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 88 462 1.0E-23
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 95 462 1.0E-22
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 91 479 2.0E-21
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 91 440 4.0E-21
sp|Q8IZM9|S38A6_HUMAN Probable sodium-coupled neutral amino acid transporter 6 OS=Homo sapiens GN=SLC38A6 PE=1 SV=2 99 457 6.0E-20
sp|Q6WWW3|S38A6_RAT Probable sodium-coupled neutral amino acid transporter 6 OS=Rattus norvegicus GN=Slc38a6 PE=2 SV=1 91 443 1.0E-19
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 51 459 1.0E-19
sp|G3UVW3|S38A6_MOUSE Probable sodium-coupled neutral amino acid transporter 6 OS=Mus musculus GN=Slc38a6 PE=2 SV=1 91 443 4.0E-19
sp|Q9H2H9|S38A1_HUMAN Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens GN=SLC38A1 PE=1 SV=1 73 440 9.0E-19
sp|Q5R443|S38A1_PONAB Sodium-coupled neutral amino acid transporter 1 OS=Pongo abelii GN=SLC38A1 PE=2 SV=1 73 440 3.0E-18
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 53 440 6.0E-18
sp|Q5I012|S38AA_MOUSE Putative sodium-coupled neutral amino acid transporter 10 OS=Mus musculus GN=Slc38a10 PE=1 SV=2 119 438 1.0E-16
sp|Q6JWR2|S38A7_RAT Putative sodium-coupled neutral amino acid transporter 7 OS=Rattus norvegicus GN=Slc38a7 PE=2 SV=1 109 452 2.0E-16
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 76 457 3.0E-16
sp|Q5R9F5|S38A7_PONAB Putative sodium-coupled neutral amino acid transporter 7 OS=Pongo abelii GN=SLC38A7 PE=2 SV=1 95 452 9.0E-16
sp|Q8BWH0|S38A7_MOUSE Putative sodium-coupled neutral amino acid transporter 7 OS=Mus musculus GN=Slc38a7 PE=1 SV=1 109 452 1.0E-15
sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT6 PE=1 SV=1 111 365 2.0E-15
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 119 440 3.0E-15
sp|A7E3U5|S38A7_BOVIN Putative sodium-coupled neutral amino acid transporter 7 OS=Bos taurus GN=SLC38A7 PE=2 SV=1 116 452 3.0E-15
sp|Q9NVC3|S38A7_HUMAN Putative sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens GN=SLC38A7 PE=1 SV=1 107 452 5.0E-15
sp|Q9JHE5|S38A2_RAT Sodium-coupled neutral amino acid transporter 2 OS=Rattus norvegicus GN=Slc38a2 PE=1 SV=1 43 459 6.0E-15
sp|E9PT23|S38AA_RAT Putative sodium-coupled neutral amino acid transporter 10 OS=Rattus norvegicus GN=Slc38a10 PE=2 SV=2 119 438 8.0E-15
sp|O74327|AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt5 PE=3 SV=1 104 364 1.0E-14
sp|Q5RC98|S38AA_PONAB Putative sodium-coupled neutral amino acid transporter 10 OS=Pongo abelii GN=SLC38A10 PE=2 SV=1 119 463 7.0E-14
sp|Q9HBR0|S38AA_HUMAN Putative sodium-coupled neutral amino acid transporter 10 OS=Homo sapiens GN=SLC38A10 PE=1 SV=2 119 463 1.0E-13
sp|Q5F468|S38A2_CHICK Sodium-coupled neutral amino acid transporter 2 OS=Gallus gallus GN=SLC38A2 PE=2 SV=2 82 440 1.0E-13
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 94 462 2.0E-13
sp|Q5E9S9|S38A5_BOVIN Sodium-coupled neutral amino acid transporter 5 OS=Bos taurus GN=SLC38A5 PE=2 SV=1 110 462 5.0E-13
sp|Q8WUX1|S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens GN=SLC38A5 PE=1 SV=1 110 462 3.0E-12
sp|Q3U1J0|S38A5_MOUSE Sodium-coupled neutral amino acid transporter 5 OS=Mus musculus GN=Slc38a5 PE=1 SV=1 110 462 6.0E-12
sp|A2VCW5|S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus GN=Slc38a5 PE=1 SV=1 110 462 7.0E-12
sp|Q6DFE7|S38A7_XENLA Putative sodium-coupled neutral amino acid transporter 7 OS=Xenopus laevis GN=slc38a7 PE=2 SV=1 105 459 9.0E-12
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 38 286 6.0E-11
sp|P38176|AVT5_YEAST Vacuolar amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT5 PE=3 SV=2 111 365 9.0E-11
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 38 286 2.0E-10
sp|Q969I6|S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens GN=SLC38A4 PE=1 SV=1 38 286 3.0E-10
sp|Q8CFE6|S38A2_MOUSE Sodium-coupled neutral amino acid transporter 2 OS=Mus musculus GN=Slc38a2 PE=1 SV=1 82 459 2.0E-09
sp|P40501|AVT7_YEAST Vacuolar amino acid transporter 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT7 PE=1 SV=1 106 366 2.0E-09
sp|A1YG32|S38A2_PANPA Sodium-coupled neutral amino acid transporter 2 OS=Pan paniscus GN=SLC38A2 PE=3 SV=1 82 440 5.0E-09
sp|Q9EQ25|S38A4_RAT Sodium-coupled neutral amino acid transporter 4 OS=Rattus norvegicus GN=Slc38a4 PE=1 SV=1 97 303 5.0E-09
sp|Q96QD8|S38A2_HUMAN Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens GN=SLC38A2 PE=1 SV=2 82 440 6.0E-09
sp|A2VE31|S38A2_BOVIN Sodium-coupled neutral amino acid transporter 2 OS=Bos taurus GN=SLC38A2 PE=2 SV=1 82 440 1.0E-08
sp|Q28I47|S38A8_XENTR Putative sodium-coupled neutral amino acid transporter 8 OS=Xenopus tropicalis GN=slc38a8 PE=2 SV=1 109 367 3.0E-08
sp|Q6PCF9|S38AA_XENLA Putative sodium-coupled neutral amino acid transporter 10 OS=Xenopus laevis GN=slc38a10 PE=2 SV=1 117 367 3.0E-08
sp|A6NNN8|S38A8_HUMAN Putative sodium-coupled neutral amino acid transporter 8 OS=Homo sapiens GN=SLC38A8 PE=1 SV=1 111 377 6.0E-08
sp|P34579|UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans GN=unc-47 PE=1 SV=2 38 366 2.0E-06
sp|Q5HZH7|S38A8_MOUSE Putative sodium-coupled neutral amino acid transporter 8 OS=Mus musculus GN=Slc38a8 PE=2 SV=1 100 377 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 116 133 17
2 143 165 22
3 186 208 22
4 212 234 22
5 239 258 19
6 263 285 22
7 297 319 22
8 339 361 22
9 389 406 17
10 416 438 22
11 445 467 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 96.60 52.25 140.95
CcL In ants, during behavior modification 79.64 42.04 117.25
CcD In ants, recently dead 61.05 33.49 88.62

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.433840 no
SC16a CcD 0.035514 yes
CcL CcD 0.258829 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6062
MTQAMREQGRGLLAGSGGGGGGGGGGGDEEEDEDGVILELESQSMEPGGGRLQDDEDGDVDDEARPSHRVPLLTD
MEAPSVAVANSFGDDDDDDDDDAADELHAEMRRPKSGLQSAFMNMANSIIGAGIIGQPYAFRQAGLLAGVLLLIG
LTVVVDWTICLIVINSKLSGTSSFQGTVEHCFGRPGLVAISLAQWVFAFGGMVAFGVIVGDTIPHVLMAVWPNLG
AVPVLGLLTDRRVAIAVFILGVSYPLTLYRDIAKLAKASTFALIGMMVIVTTVLVQGLLVPSEARGSFSTPLLTV
NGGIFQAIGVISFAFVCHHNSLLIYGSLRTPTMDNFSRVTHYSTGVSMLACLVMALAGFLTFGDKTAFVCREVMV
TYWYPDAGFDMRRHLVFSTGLVAAATAMSLLTCDLGVVFELVGATSAVAMAYILPPLCYIRLTRRSWRTYLAYAI
VVFGVAVMVISVVQAVGAALGGGGRGEGEAAVCR
Coding >Ophio5|6062
ATGACTCAGGCGATGCGCGAACAGGGCCGAGGCCTGCTGGCGGGCAGCGGCGGAGGAGGCGGTGGTGGCGGCGGC
GGCGGCGATGAGGAGGAGGACGAAGACGGCGTGATACTGGAGCTCGAATCGCAATCGATGGAGCCCGGCGGCGGC
AGATTACAAGACGACGAGGATGGCGACGTCGACGACGAAGCGAGGCCTTCGCACCGGGTGCCGCTTCTGACCGAC
ATGGAGGCTCCCAGCGTCGCCGTGGCCAACTCGTTCGGCGACGACGACGACGACGACGACGACGACGCGGCGGAC
GAGCTACACGCGGAGATGCGACGGCCCAAGTCCGGCCTACAATCGGCCTTTATGAACATGGCCAACTCCATCATC
GGCGCGGGCATCATCGGCCAGCCTTACGCGTTCCGACAAGCCGGCCTTTTGGCGGGCGTGTTGTTACTGATAGGG
CTGACGGTGGTGGTCGACTGGACCATCTGCCTCATCGTCATCAACAGCAAGCTCAGCGGAACCAGCAGCTTCCAG
GGCACCGTCGAGCACTGCTTCGGCAGGCCTGGGCTGGTGGCCATCAGTTTGGCGCAGTGGGTGTTTGCCTTTGGC
GGCATGGTGGCCTTTGGCGTCATCGTCGGCGATACGATTCCCCATGTCTTGATGGCTGTTTGGCCCAACCTCGGC
GCGGTGCCGGTTTTGGGGCTGTTGACGGATAGGAGGGTGGCTATCGCCGTCTTCATATTGGGCGTGAGCTACCCG
TTGACGCTGTACCGAGACATTGCCAAGCTGGCCAAAGCGAGCACGTTTGCTCTCATCGGCATGATGGTCATCGTG
ACGACGGTGCTGGTTCAGGGTCTGCTGGTGCCGTCGGAGGCGCGTGGATCGTTCAGCACGCCGCTTCTGACGGTC
AACGGGGGCATCTTCCAAGCCATTGGCGTGATATCATTCGCCTTCGTGTGCCACCACAACTCGCTCCTCATCTAC
GGCTCTCTTCGAACGCCAACCATGGACAACTTCTCGCGGGTGACGCACTACTCGACGGGCGTCTCGATGCTAGCC
TGCCTCGTCATGGCCCTCGCCGGCTTCCTCACCTTTGGCGACAAAACGGCCTTTGTCTGCCGCGAGGTCATGGTA
ACGTATTGGTACCCCGACGCCGGCTTCGACATGCGACGACACCTCGTCTTCAGCACGGGGCTCGTCGCAGCCGCC
ACGGCCATGAGTCTGCTGACGTGCGACCTGGGCGTCGTCTTCGAGCTCGTCGGCGCCACTAGCGCCGTCGCCATG
GCTTATATCCTTCCGCCCCTGTGCTATATCCGTCTGACGCGGCGTAGCTGGCGTACCTACCTGGCCTACGCCATT
GTCGTCTTCGGCGTCGCTGTCATGGTCATCAGTGTGGTTCAGGCGGTCGGTGCTGCGTTGGGGGGGGGGGGGCGC
GGCGAGGGGGAGGCGGCCGTCTGTAGG
Transcript >Ophio5|6062
ATGACTCAGGCGATGCGCGAACAGGGCCGAGGCCTGCTGGCGGGCAGCGGCGGAGGAGGCGGTGGTGGCGGCGGC
GGCGGCGATGAGGAGGAGGACGAAGACGGCGTGATACTGGAGCTCGAATCGCAATCGATGGAGCCCGGCGGCGGC
AGATTACAAGACGACGAGGATGGCGACGTCGACGACGAAGCGAGGCCTTCGCACCGGGTGCCGCTTCTGACCGAC
ATGGAGGCTCCCAGCGTCGCCGTGGCCAACTCGTTCGGCGACGACGACGACGACGACGACGACGACGCGGCGGAC
GAGCTACACGCGGAGATGCGACGGCCCAAGTCCGGCCTACAATCGGCCTTTATGAACATGGCCAACTCCATCATC
GGCGCGGGCATCATCGGCCAGCCTTACGCGTTCCGACAAGCCGGCCTTTTGGCGGGCGTGTTGTTACTGATAGGG
CTGACGGTGGTGGTCGACTGGACCATCTGCCTCATCGTCATCAACAGCAAGCTCAGCGGAACCAGCAGCTTCCAG
GGCACCGTCGAGCACTGCTTCGGCAGGCCTGGGCTGGTGGCCATCAGTTTGGCGCAGTGGGTGTTTGCCTTTGGC
GGCATGGTGGCCTTTGGCGTCATCGTCGGCGATACGATTCCCCATGTCTTGATGGCTGTTTGGCCCAACCTCGGC
GCGGTGCCGGTTTTGGGGCTGTTGACGGATAGGAGGGTGGCTATCGCCGTCTTCATATTGGGCGTGAGCTACCCG
TTGACGCTGTACCGAGACATTGCCAAGCTGGCCAAAGCGAGCACGTTTGCTCTCATCGGCATGATGGTCATCGTG
ACGACGGTGCTGGTTCAGGGTCTGCTGGTGCCGTCGGAGGCGCGTGGATCGTTCAGCACGCCGCTTCTGACGGTC
AACGGGGGCATCTTCCAAGCCATTGGCGTGATATCATTCGCCTTCGTGTGCCACCACAACTCGCTCCTCATCTAC
GGCTCTCTTCGAACGCCAACCATGGACAACTTCTCGCGGGTGACGCACTACTCGACGGGCGTCTCGATGCTAGCC
TGCCTCGTCATGGCCCTCGCCGGCTTCCTCACCTTTGGCGACAAAACGGCCTTTGTCTGCCGCGAGGTCATGGTA
ACGTATTGGTACCCCGACGCCGGCTTCGACATGCGACGACACCTCGTCTTCAGCACGGGGCTCGTCGCAGCCGCC
ACGGCCATGAGTCTGCTGACGTGCGACCTGGGCGTCGTCTTCGAGCTCGTCGGCGCCACTAGCGCCGTCGCCATG
GCTTATATCCTTCCGCCCCTGTGCTATATCCGTCTGACGCGGCGTAGCTGGCGTACCTACCTGGCCTACGCCATT
GTCGTCTTCGGCGTCGCTGTCATGGTCATCAGTGTGGTTCAGGCGGTCGGTGCTGCGTTGGGGGGGGGGGGGCGC
GGCGAGGGGGAGGCGGCCGTCTGTAGGTGA
Gene >Ophio5|6062
ATGACTCAGGCGATGCGCGAACAGGGCCGAGGCCTGCTGGCGGGCAGCGGCGGAGGAGGCGGTGGTGGCGGCGGC
GGCGGCGATGAGGAGGAGGACGAAGACGGCGTGATACTGGAGCTCGAATCGCAATCGATGGAGCCCGGCGGCGGC
AGATTACAAGACGACGAGGATGGCGACGTCGACGACGAAGCGAGGCCTTCGCACCGGGTGCCGCTTCTGACCGAC
ATGGAGGCTCCCAGCGTCGCCGTGGCCAACTCGTTCGGCGACGACGACGACGACGACGACGACGACGCGGCGGAC
GAGCTACACGCGGAGATGCGACGGCCCAAGTCCGGCCTACAATCGGCCTTTATGAACATGGCCAACTCCATCATC
GGCGCGGGCATCATCGGCCAGCCTTACGCGTTCCGACAAGCCGGCCTTTTGGCGGGCGTGTTGTTACTGATAGGG
CTGACGGTGGTGGTCGACTGGACCATCTGCCTCATCGTCATCAACAGCAAGCTCAGCGGAACCAGCAGCTTCCAG
GGCACCGTCGAGCACTGCTTCGGCAGGCCTGGGCTGGTGGCCATCAGTTTGGCGCAGTGGGTGTTTGCCTTTGGC
GGCATGGTGGCCTTTGGCGTCATCGTCGGCGATACGATTCCCCATGTCTTGATGGCTGTTTGGCCCAACCTCGGC
GCGGTGCCGGTTTTGGGGCTGTTGACGGATAGGAGGGTGGCTATCGCCGTCTTCATATTGGGCGTGAGCTACCCG
TTGACGCTGTACCGAGACATTGCCAAGGTGAGAGAGAGCTCTTGCACTGCACGTCACTGGTTTTTCCCCTGTTCC
TTTTTTTTTTGGGGGGGGGGGGCGGAGGAGGACGGGGTTTTCTCGATCTGGCGGCTGAAAACGGCTGAGGAGAGT
AGCTGGCCAAAGCGAGCACGTTTGCTCTCATCGGCATGATGGTCATCGTGACGACGGTGCTGGTTCAGGGTCTGC
TGGTGCCGTCGGAGGCGCGTGGATCGTTCAGCACGCCGCTTCTGACGGTCAACGGGGGCATCTTCCAAGCCATTG
GCGTGATATCATTCGGTATGTTTTTGGATCGTCTCTTGGAGTGACCGGGACAGACTGACACAGTTTCCTGACAGC
CTTCGTGTGCCACCACAACTCGCTCCTCATCTACGGCTCTCTTCGAACGCCAACCATGGACAACTTCTCGCGGGT
GACGCACTACTCGACGGGCGTCTCGATGCTAGCCTGCCTCGTCATGGCCCTCGCCGGCTTCCTCACCTTTGGCGA
CAAAACGGTGGGCAACGTGCTCAACAACTTCCCCTCCAACAACTCCATGGTCAACCTCGCGCGCCTCTTCTTCGG
ACTTAACATGCTGACGACGCTGCCGCTCGAGGCCTTTGTCTGCCGCGAGGTCATGGTAACGTATTGGTACCCCGA
CGCCGGCTTCGACATGCGACGACACCTCGTCTTCAGCACGGGGCTCGTCGCAGCCGCCACGGCCATGAGTCTGCT
GACGTGCGACCTGGGCGTCGTCTTCGAGCTCGTCGGCGCCACTAGCGCCGTCGCCATGGCTTATATCCTTCCGCC
CCTGTGCTATATCCGTCTGACGCGGCGTAGCTGGCGTACCTACCTGGCCTACGCCATTGTCGTCTTCGGCGTCGC
TGTCATGGTCATCAGTGTGGTTCAGGCGGTCGGTGCTGCGTTGGGGGGGGGGGGGCGCGGCGAGGGGGAGGCGGC
CGTCTGTAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail