Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6058
Gene name
Locationscaffold_512:6020..6943
Strand-
Gene length (bp)923
Transcript length (bp)687
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04420 CHD5 CHD5-like protein 2.5E-52 7 154

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RHX3|GET1_MAGO7 Protein GET1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GET1 PE=3 SV=2 1 149 9.0E-61
sp|Q7S0A1|GET1_NEUCR Protein get-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=get-1 PE=3 SV=1 1 149 7.0E-58
sp|A7EF54|GET1_SCLS1 Protein get1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=get1 PE=3 SV=2 1 149 1.0E-55
sp|B2B0S1|GET1_PODAN Protein GET1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GET1 PE=3 SV=1 1 149 5.0E-55
sp|A6RUY7|GET1_BOTFB Protein get1 OS=Botryotinia fuckeliana (strain B05.10) GN=get1 PE=3 SV=2 1 149 3.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RHX3|GET1_MAGO7 Protein GET1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GET1 PE=3 SV=2 1 149 9.0E-61
sp|Q7S0A1|GET1_NEUCR Protein get-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=get-1 PE=3 SV=1 1 149 7.0E-58
sp|A7EF54|GET1_SCLS1 Protein get1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=get1 PE=3 SV=2 1 149 1.0E-55
sp|B2B0S1|GET1_PODAN Protein GET1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GET1 PE=3 SV=1 1 149 5.0E-55
sp|A6RUY7|GET1_BOTFB Protein get1 OS=Botryotinia fuckeliana (strain B05.10) GN=get1 PE=3 SV=2 1 149 3.0E-54
sp|Q2GNR9|GET1_CHAGB Protein GET1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GET1 PE=3 SV=1 16 149 9.0E-54
sp|Q4WNN2|GET1_ASPFU Protein get1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=get1 PE=3 SV=1 1 149 1.0E-45
sp|B0Y5H9|GET1_ASPFC Protein get1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=get1 PE=3 SV=1 1 149 1.0E-45
sp|A1CXY5|GET1_NEOFI Protein get1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=get1 PE=3 SV=1 1 149 6.0E-45
sp|Q0CL45|GET1_ASPTN Protein get1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=get1 PE=3 SV=2 1 149 1.0E-44
sp|A2QHQ3|GET1_ASPNC Protein get1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=get1 PE=3 SV=1 1 149 2.0E-43
sp|B6HS10|GET1_PENRW Protein get1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=get1 PE=3 SV=1 1 149 9.0E-43
sp|Q2UG70|GET1_ASPOR Protein get1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=get1 PE=3 SV=1 1 149 1.0E-41
sp|B8NA66|GET1_ASPFN Protein get1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=get1 PE=3 SV=2 1 149 1.0E-41
sp|C4JT27|GET1_UNCRE Protein GET1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=GET1 PE=3 SV=1 1 149 1.0E-39
sp|C0NIJ2|GET1_AJECG Protein GET1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=GET1 PE=3 SV=1 1 149 2.0E-39
sp|Q0UTI3|GET1_PHANO Protein GET1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GET1 PE=3 SV=1 1 149 3.0E-39
sp|A1CGU5|GET1_ASPCL Protein get1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=get1 PE=3 SV=1 1 149 3.0E-39
sp|C5P8K5|GET1_COCP7 Protein GET1 OS=Coccidioides posadasii (strain C735) GN=GET1 PE=3 SV=1 1 149 3.0E-39
sp|A6RH42|GET1_AJECN Protein GET1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=GET1 PE=3 SV=1 1 149 8.0E-39
sp|Q1DZS0|GET1_COCIM Protein GET1 OS=Coccidioides immitis (strain RS) GN=GET1 PE=3 SV=2 1 149 1.0E-38
sp|C5FEL7|GET1_ARTOC Protein GET1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=GET1 PE=3 SV=1 1 149 2.0E-38
sp|B8LUE3|GET1_TALSN Protein get1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=get1 PE=3 SV=1 16 149 3.0E-38
sp|C6H7W0|GET1_AJECH Protein GET1 OS=Ajellomyces capsulatus (strain H143) GN=GET1 PE=3 SV=1 1 149 3.0E-38
sp|B6Q234|GET1_TALMQ Protein get1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=get1 PE=3 SV=1 16 149 6.0E-38
sp|Q5B538|GET1_EMENI Protein get1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=get1 PE=3 SV=2 1 154 1.0E-37
sp|B2W1P8|GET1_PYRTR Protein get1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=get1 PE=3 SV=1 1 149 2.0E-37
sp|C5JW43|GET1_AJEDS Protein GET1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=GET1 PE=3 SV=1 16 149 3.0E-37
sp|C5G729|GET1_AJEDR Protein GET1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=GET1 PE=3 SV=1 16 149 3.0E-37
sp|C1H0T6|GET1_PARBA Protein GET1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GET1 PE=3 SV=1 1 149 1.0E-34
sp|C0S9J4|GET1_PARBP Protein GET1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=GET1 PE=3 SV=1 1 149 3.0E-34
sp|C1GC25|GET1_PARBD Protein GET1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=GET1 PE=3 SV=1 1 149 3.0E-34
sp|P0CS59|GET1_CRYNB Protein GET1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GET1 PE=3 SV=1 1 154 2.0E-28
sp|P0CS58|GET1_CRYNJ Protein GET1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GET1 PE=3 SV=1 1 154 2.0E-28
sp|C5M5F1|GET1_CANTT Golgi to ER traffic protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GET1 PE=3 SV=1 8 149 6.0E-21
sp|C4YJ00|GET1_CANAW Golgi to ER traffic protein 1 OS=Candida albicans (strain WO-1) GN=GET1 PE=3 SV=1 8 149 2.0E-20
sp|A3LMX9|GET1_PICST Golgi to ER traffic protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=GET1 PE=3 SV=2 4 149 2.0E-20
sp|A8N7T9|GET1_COPC7 Protein GET1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=GET1 PE=3 SV=1 2 160 2.0E-20
sp|A5DFM9|GET1_PICGU Golgi to ER traffic protein 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GET1 PE=3 SV=3 4 154 2.0E-20
sp|C4R7S7|GET1_PICPG Golgi to ER traffic protein 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=GET1 PE=3 SV=1 18 154 4.0E-20
sp|Q5ACW6|GET1_CANAL Golgi to ER traffic protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GET1 PE=3 SV=1 8 149 9.0E-20
sp|Q9HGM2|GET1_SCHPO Protein get1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=get1 PE=1 SV=1 1 154 1.0E-19
sp|B9WA88|GET1_CANDC Golgi to ER traffic protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GET1 PE=3 SV=1 8 149 2.0E-19
sp|C4XXV8|GET1_CLAL4 Golgi to ER traffic protein 1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=GET1 PE=3 SV=1 3 154 6.0E-19
sp|Q6BYU3|GET1_DEBHA Golgi to ER traffic protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GET1 PE=3 SV=1 3 149 1.0E-17
sp|B0D1L7|GET1_LACBS Protein GET1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GET1 PE=3 SV=1 2 149 2.0E-17
sp|Q6C555|GET1_YARLI Golgi to ER traffic protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GET1 PE=3 SV=1 15 150 1.0E-16
sp|A8PTK5|GET1_MALGO Protein GET1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=GET1 PE=3 SV=1 34 173 5.0E-13
sp|A5DV09|GET1_LODEL Golgi to ER traffic protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GET1 PE=3 SV=1 6 149 2.0E-11
sp|B6JZY9|GET1_SCHJY Protein get1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=get1 PE=3 SV=1 36 154 4.0E-11
sp|C5DHW0|GET1_LACTC Golgi to ER traffic protein 1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=GET1 PE=3 SV=1 56 147 9.0E-10
sp|Q6P6S5|WRB_RAT Tail-anchored protein insertion receptor WRB OS=Rattus norvegicus GN=Wrb PE=2 SV=1 17 154 6.0E-09
sp|Q8K0D7|WRB_MOUSE Tail-anchored protein insertion receptor WRB OS=Mus musculus GN=Wrb PE=1 SV=1 22 154 4.0E-08
sp|Q6CXX9|GET1_KLULA Golgi to ER traffic protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GET1 PE=3 SV=1 31 143 2.0E-07
sp|Q5R6K7|WRB_PONAB Tail-anchored protein insertion receptor WRB OS=Pongo abelii GN=WRB PE=2 SV=1 43 154 3.0E-07
sp|O00258|WRB_HUMAN Tail-anchored protein insertion receptor WRB OS=Homo sapiens GN=WRB PE=1 SV=2 43 154 3.0E-07
sp|Q3SZ26|WRB_BOVIN Tail-anchored protein insertion receptor WRB OS=Bos taurus GN=WRB PE=2 SV=1 43 154 6.0E-07
sp|Q6DRM0|WRB_DANRE Tail-anchored protein insertion receptor WRB OS=Danio rerio GN=wrb PE=2 SV=1 6 154 1.0E-06
sp|A7TKW8|GET1_VANPO Golgi to ER traffic protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GET1 PE=3 SV=1 50 226 2.0E-06
sp|Q754R6|GET1_ASHGO Golgi to ER traffic protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GET1 PE=3 SV=2 49 143 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071816 tail-anchored membrane protein insertion into ER membrane Yes
GO:0045184 establishment of protein localization No
GO:0090150 establishment of protein localization to membrane No
GO:0051641 cellular localization No
GO:0051668 localization within membrane No
GO:0072657 protein localization to membrane No
GO:0009987 cellular process No
GO:0051205 protein insertion into membrane No
GO:0033036 macromolecule localization No
GO:0051234 establishment of localization No
GO:0008104 protein localization No
GO:0008150 biological_process No
GO:0070727 cellular macromolecule localization No
GO:0051179 localization No
GO:0045048 protein insertion into ER membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6058
MLDLVFLIFAIELVAHLVNTIGSSRINGLAWTLINYLPVSTSKAAAQQRQLQTEYLKVRRDLNATSSQDEFAKWA
KLRRQHDKLLEKLEASKKGLEASRAKFDNFLWVARLLLTKLPQYFVPFWYGKQPMFWLPHGWFPYYAEWIISFPT
RMHGLHRPGIRLGGLGRLHFLPGVQVQRGCKASTEGGHGGEDLVVAAASSPGCAGIDGEAGERKGIIGATLTGEL
ELV
Coding >Ophio5|6058
ATGCTAGACCTCGTCTTCCTGATATTTGCCATCGAGCTGGTGGCGCATCTGGTCAATACCATCGGCTCATCGCGT
ATCAACGGCCTGGCCTGGACCTTGATCAACTACCTGCCCGTCTCGACGTCCAAGGCTGCCGCCCAGCAGCGCCAG
CTTCAAACCGAATATCTCAAGGTGCGGCGGGATCTCAACGCGACGAGCAGTCAAGACGAGTTCGCCAAATGGGCC
AAGCTGCGGCGTCAACACGACAAGCTGCTCGAAAAGCTTGAAGCGTCGAAAAAGGGACTCGAGGCCTCGAGGGCC
AAGTTCGACAACTTCCTCTGGGTCGCTCGACTACTGTTGACCAAGCTGCCGCAATATTTTGTTCCCTTCTGGTAC
GGCAAGCAGCCCATGTTCTGGCTGCCTCACGGCTGGTTCCCATACTACGCGGAATGGATCATCTCCTTTCCCACT
CGCATGCACGGGCTTCATCGCCCTGGTATCCGACTTGGTGGTCTTGGTCGCCTCCATTTTCTTCCCGGCGTCCAA
GTCCAAAGAGGGTGCAAGGCAAGCACAGAAGGCGGGCACGGAGGCGAAGACTTGGTCGTCGCCGCAGCGTCAAGC
CCAGGCTGTGCCGGCATCGACGGCGAAGCGGGAGAGCGAAAAGGAATTATAGGCGCGACTCTCACGGGAGAACTG
GAGTTGGTT
Transcript >Ophio5|6058
ATGCTAGACCTCGTCTTCCTGATATTTGCCATCGAGCTGGTGGCGCATCTGGTCAATACCATCGGCTCATCGCGT
ATCAACGGCCTGGCCTGGACCTTGATCAACTACCTGCCCGTCTCGACGTCCAAGGCTGCCGCCCAGCAGCGCCAG
CTTCAAACCGAATATCTCAAGGTGCGGCGGGATCTCAACGCGACGAGCAGTCAAGACGAGTTCGCCAAATGGGCC
AAGCTGCGGCGTCAACACGACAAGCTGCTCGAAAAGCTTGAAGCGTCGAAAAAGGGACTCGAGGCCTCGAGGGCC
AAGTTCGACAACTTCCTCTGGGTCGCTCGACTACTGTTGACCAAGCTGCCGCAATATTTTGTTCCCTTCTGGTAC
GGCAAGCAGCCCATGTTCTGGCTGCCTCACGGCTGGTTCCCATACTACGCGGAATGGATCATCTCCTTTCCCACT
CGCATGCACGGGCTTCATCGCCCTGGTATCCGACTTGGTGGTCTTGGTCGCCTCCATTTTCTTCCCGGCGTCCAA
GTCCAAAGAGGGTGCAAGGCAAGCACAGAAGGCGGGCACGGAGGCGAAGACTTGGTCGTCGCCGCAGCGTCAAGC
CCAGGCTGTGCCGGCATCGACGGCGAAGCGGGAGAGCGAAAAGGAATTATAGGCGCGACTCTCACGGGAGAACTG
GAGTTGGTTTAG
Gene >Ophio5|6058
ATGCTAGACCTCGTCTTCCTGATATTTGCCATCGAGCTGGTGGCGCATCTGGTCAATACCATCGGCTCATCGCGT
ATCAACGGCCTGGTACCCCCTCCCTCCCCGTCGAGCCGGCACCCGCGAGGCCGACCGACACTGACGGCTCACCAG
GCCTGGACCTTGATCAACTACCTGCCCGTCTCGACGTCCAAGGCTGCCGCCCAGCAGCGCCAGCTTCAAACCGAA
TATCTCAAGGTGCGGCGGGATCTCAACGCGACGAGCAGTCAAGACGAGTTCGCCAAATGGGCCAAGCTGCGGCGT
CAACACGACAAGCTGCTCGAAAAGCTTGAAGCGTCGAGTACGTCTGTTCGGTAGCACTGCTCGCGAGGATTGGGA
CTGACGAGGAGGAAATGGCCGCAGAAAAGGGACTCGAGGCCTCGAGGGCCAAGTTCGACAACTTCCTCTGGGTCG
CTCGACTACTGTTGACCAAGCTGCCGCAATATTTTGTTCCCTTCTGGTACGGCAAGCAGCCCATGTTCTGGCTGC
CTCACGGCTGGTTCCCATACTACGCGGAATGGATCATCTCCTTTCCCAGTGCGCCTCTGGGTAGCGTGAGCGCCC
CGTCGTGGCAGCTCGCATGCACGGGCTTCATCGCCCTGGTATCCGACTTGGTGGTCTTGGTCGCCTCCATTTTCT
TCCCGGCGTCCAAGTCCAAAGAGGGTGCAAGGCAAGCACAGAAGGCGGGCACGGAGGCGAAGACTTGGTCGTCGC
CGCAGCGTCAAGCCCAGGCTGTGCCGGCATCGACGGCGAAGCGGGAGAGCGAAAAGGAATTATAGGCGCGACTCT
CACGGGGCAAGACAATGTTTCTCGTTGAAATTGACGCAAAGTTCCCCATGGCTAATGCTAGGACTTTGTAACACG
ACAGAGAACTGGAGTTGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail