Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6051
Gene name
Locationscaffold_511:1186..2315
Strand-
Gene length (bp)1129
Transcript length (bp)843
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19117 Mim2 Mitochondrial import 2 1.5E-23 25 68

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G2TRP0|TAM7_SCHPO Uncharacterized protein tam7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tam7 PE=2 SV=1 33 67 2.0E-06

GO

GO Term Description Terminal node
GO:0045040 protein insertion into mitochondrial outer membrane Yes
GO:0070096 mitochondrial outer membrane translocase complex assembly Yes
GO:0051179 localization No
GO:0007008 outer mitochondrial membrane organization No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0051668 localization within membrane No
GO:0072655 establishment of protein localization to mitochondrion No
GO:0033036 macromolecule localization No
GO:0009987 cellular process No
GO:0070585 protein localization to mitochondrion No
GO:0061024 membrane organization No
GO:0006810 transport No
GO:0006886 intracellular protein transport No
GO:0007005 mitochondrion organization No
GO:0051234 establishment of localization No
GO:0033365 protein localization to organelle No
GO:0071705 nitrogen compound transport No
GO:0070727 cellular macromolecule localization No
GO:0008150 biological_process No
GO:0043933 protein-containing complex organization No
GO:0090150 establishment of protein localization to membrane No
GO:0015031 protein transport No
GO:0006996 organelle organization No
GO:0071840 cellular component organization or biogenesis No
GO:0071702 organic substance transport No
GO:0090151 establishment of protein localization to mitochondrial membrane No
GO:0007006 mitochondrial membrane organization No
GO:0065003 protein-containing complex assembly No
GO:0072657 protein localization to membrane No
GO:0045184 establishment of protein localization No
GO:0051205 protein insertion into membrane No
GO:0022607 cellular component assembly No
GO:0046907 intracellular transport No
GO:0051204 protein insertion into mitochondrial membrane No
GO:0006839 mitochondrial transport No
GO:0016043 cellular component organization No
GO:0072594 establishment of protein localization to organelle No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6051
MADSDDVDSLPSLSTTEIYSDSEPDAQAEWERSLEQLQLVLTMILVPWLGKYFGRKFAYWGWARYMEWMHNVEIR
WTNKRLFKGRQLCIHESSSLIRRRLLRHYVEEIRKEEDAERARDKEKAIRRLCHLRHVGPRVIPTTEAEAPRGPD
AEYEPKRQADPEEPHEGGAGLNLAAALDVVLCAPADPSTVVGSDVDGAAVGGAELTGEDDGADKGEEDGQGVEGY
HEDRADHGWDEGGEEAHVTDDGRDKQDPDEGADAREELADVDHGDGVGAAFFLLL
Coding >Ophio5|6051
ATGGCCGACTCGGATGACGTCGACTCGCTGCCGTCGCTGTCCACGACCGAAATCTACTCCGATTCGGAGCCGGAC
GCGCAGGCCGAGTGGGAGCGCAGTCTAGAGCAGCTACAGCTTGTTCTGACCATGATACTGGTGCCGTGGCTGGGG
AAATACTTTGGCCGCAAATTTGCCTACTGGGGTTGGGCGCGGTACATGGAGTGGATGCACAACGTCGAGATCCGC
TGGACCAACAAGCGCCTCTTCAAAGGGCGTCAACTCTGCATACATGAATCTTCATCCCTGATTCGACGACGGCTG
CTGCGGCATTATGTAGAAGAGATAAGAAAAGAAGAAGATGCGGAGAGGGCAAGAGACAAGGAAAAGGCGATTCGC
AGGCTATGCCACCTGAGACATGTTGGGCCGCGGGTAATACCGACGACGGAAGCTGAGGCTCCCCGCGGACCTGAT
GCTGAATATGAGCCCAAACGACAGGCTGACCCAGAGGAACCACATGAAGGAGGTGCTGGCCTGAATCTCGCGGCA
GCGCTTGACGTCGTTCTTTGCGCCCCAGCCGATCCATCGACGGTGGTGGGGAGTGACGTGGACGGCGCCGCAGTT
GGGGGCGCCGAGCTCACCGGCGAGGACGACGGCGCTGACAAAGGTGAAGAAGACGGCCAGGGCGTCGAGGGGTAT
CATGAAGACCGGGCAGACCATGGCTGGGATGAAGGAGGCGAAGAAGCCCACGTTACCGATGACGGCCGTGACAAG
CAGGACCCAGATGAGGGCGCTGATGCGCGAGAGGAGCTGGCCGACGTCGACCATGGTGACGGTGTTGGGGCTGCT
TTCTTTCTTCTTCTT
Transcript >Ophio5|6051
ATGGCCGACTCGGATGACGTCGACTCGCTGCCGTCGCTGTCCACGACCGAAATCTACTCCGATTCGGAGCCGGAC
GCGCAGGCCGAGTGGGAGCGCAGTCTAGAGCAGCTACAGCTTGTTCTGACCATGATACTGGTGCCGTGGCTGGGG
AAATACTTTGGCCGCAAATTTGCCTACTGGGGTTGGGCGCGGTACATGGAGTGGATGCACAACGTCGAGATCCGC
TGGACCAACAAGCGCCTCTTCAAAGGGCGTCAACTCTGCATACATGAATCTTCATCCCTGATTCGACGACGGCTG
CTGCGGCATTATGTAGAAGAGATAAGAAAAGAAGAAGATGCGGAGAGGGCAAGAGACAAGGAAAAGGCGATTCGC
AGGCTATGCCACCTGAGACATGTTGGGCCGCGGGTAATACCGACGACGGAAGCTGAGGCTCCCCGCGGACCTGAT
GCTGAATATGAGCCCAAACGACAGGCTGACCCAGAGGAACCACATGAAGGAGGTGCTGGCCTGAATCTCGCGGCA
GCGCTTGACGTCGTTCTTTGCGCCCCAGCCGATCCATCGACGGTGGTGGGGAGTGACGTGGACGGCGCCGCAGTT
GGGGGCGCCGAGCTCACCGGCGAGGACGACGGCGCTGACAAAGGTGAAGAAGACGGCCAGGGCGTCGAGGGGTAT
CATGAAGACCGGGCAGACCATGGCTGGGATGAAGGAGGCGAAGAAGCCCACGTTACCGATGACGGCCGTGACAAG
CAGGACCCAGATGAGGGCGCTGATGCGCGAGAGGAGCTGGCCGACGTCGACCATGGTGACGGTGTTGGGGCTGCT
TTCTTTCTTCTTCTTTGA
Gene >Ophio5|6051
ATGGCCGACTCGGATGACGTCGACTCGCTGCCGTCGCTGTCCACGACCGAAATCTACTCCGATTCGGAGCCGGAC
GCGCAGGCCGAGTGGGAGCGCAGTCTAGAGCAGCTACAGCTTGTTCTGACCATGATACTGGTGCCGTGGCTGGGG
AAATACTTTGGCCGCAAATTTGCCTACTGGGGTGAGTTGGCGACGTCGCCAAAAAAAGTCAAGACTCCTTTCGCG
CTGACCACACACACACACACACACACACACACACAGGTTGGGCGCGGTACATGGAGTGGATGCACAACGTCGAGA
TCCGCTGGACCAACAAGCGCCTCTTCAAAGTCGCAGGCGCCGTCGAGGCTGCGACCACGCTGTGATGAAAAGATC
TAGATTACTATTTATATAAGGGGCGTCAACTCTGCATACATGAATCTTCATCCCTGATTCGACGACGGCTGCTGC
GGCATTATGTAGAAGAGATGTGCGTGTATGATGCAGGGAATCATGTGCCCCGGACGGGGGAATAACAGACGACAG
AAGAAAAGAAGAAGATGCGGAGAGGGCAAGAGACAAGGAAAAGGCGATTCGCAGGCTATGCCACCTGAGACATGT
TGGGCCGCGGGTAATACCGACGACGGAAGCTGAGGCTCCCCGCGGACCTGATGCTGAATATGAGCCCAAACGACA
GGCTGACCCAGAGGAACCACATGAAGGAGGTGCTGGCCTGAATCTCGCGGCAGCGCTTGACGTCGTTCTTTGCGC
CCCAGCCGATCCATCGACGGTGGTGGGGAGTGACGTGGACGGCGCCGCAGTTGGGGGCGCCGAGCTCACCGGCGA
GGACGACGGCGCTGACAAAGGTGAAGAAGACGGCCAGGGCGTCGAGGGGTATCATGAAGACCGGGCAGACCATGG
CTGGGATGAAGGAGGCGAAGAAGCCGTATAAGGCTGGAAACCAGGCCAAGGCGGCACAGAACATGGTGAAGTTGA
GGGGCGCCATGTAGCCATTGATGTTGTTGTGCAGCACGTTACCGATGACGGCCGTGACAAGCAGGACCCAGATGA
GGGCGCTGATGCGCGAGAGGAGCTGGCCGACGTCGACCATGGTGACGGTGTTGGGGCTGCTTTCTTTCTTCTTCT
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail