Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6050
Gene name
Locationscaffold_51:55574..57356
Strand+
Gene length (bp)1782
Transcript length (bp)1647
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01019 G_glu_transpept Gamma-glutamyltranspeptidase 1.0E-143 49 540

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 14 548 0.0E+00
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 19 540 3.0E-104
sp|Q60928|GGT1_MOUSE Gamma-glutamyltranspeptidase 1 OS=Mus musculus GN=Ggt1 PE=1 SV=1 34 540 5.0E-101
sp|P19440|GGT1_HUMAN Gamma-glutamyltranspeptidase 1 OS=Homo sapiens GN=GGT1 PE=1 SV=2 34 515 9.0E-101
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 34 540 8.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 14 548 0.0E+00
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 19 540 3.0E-104
sp|Q60928|GGT1_MOUSE Gamma-glutamyltranspeptidase 1 OS=Mus musculus GN=Ggt1 PE=1 SV=1 34 540 5.0E-101
sp|P19440|GGT1_HUMAN Gamma-glutamyltranspeptidase 1 OS=Homo sapiens GN=GGT1 PE=1 SV=2 34 515 9.0E-101
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 34 540 8.0E-98
sp|Q9M0G0|GAGT3_ARATH Gamma-glutamyltranspeptidase 3 OS=Arabidopsis thaliana GN=GGT3 PE=2 SV=1 29 501 2.0E-93
sp|O14194|GGT2_SCHPO Gamma-glutamyltranspeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt2 PE=2 SV=1 31 511 4.0E-93
sp|Q9US04|GGT1_SCHPO Gamma-glutamyltranspeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt1 PE=2 SV=1 29 542 7.0E-92
sp|A6NGU5|GGT3_HUMAN Putative gamma-glutamyltranspeptidase 3 OS=Homo sapiens GN=GGT3P PE=5 SV=2 34 515 1.0E-91
sp|P36268|GGT2_HUMAN Inactive gamma-glutamyltranspeptidase 2 OS=Homo sapiens GN=GGT2 PE=1 SV=3 34 515 3.0E-89
sp|Q8VYW6|GAGT1_ARATH Gamma-glutamyltranspeptidase 1 OS=Arabidopsis thaliana GN=GGT1 PE=2 SV=1 33 508 2.0E-85
sp|Q680I5|GAGT2_ARATH Gamma-glutamyltranspeptidase 2 OS=Arabidopsis thaliana GN=GGT2 PE=2 SV=1 33 493 9.0E-85
sp|P18956|GGT_ECOLI Gamma-glutamyltranspeptidase OS=Escherichia coli (strain K12) GN=ggt PE=1 SV=1 30 541 6.0E-79
sp|P36267|GGT_PSEUA Gamma-glutamyltranspeptidase OS=Pseudomonas sp. (strain A14) GN=ggt PE=1 SV=1 23 540 2.0E-76
sp|Q9I406|GGT_PSEAE Gamma-glutamyltranspeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ggt PE=3 SV=1 33 487 5.0E-65
sp|Q05902|ECM38_YEAST Gamma-glutamyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM38 PE=1 SV=1 33 493 4.0E-61
sp|Q05053|PAC1_PSESV Acylase ACY 1 OS=Pseudomonas sp. (strain V22) GN=acyI PE=1 SV=2 33 481 8.0E-56
sp|P15557|PAC1_PSES3 Acylase ACY 1 OS=Pseudomonas sp. (strain SE83) GN=acyI PE=1 SV=2 33 481 5.0E-55
sp|P54422|GGT_BACSU Gamma-glutamyltranspeptidase OS=Bacillus subtilis (strain 168) GN=ggt PE=1 SV=1 31 482 6.0E-55
sp|P63186|GGT_BACNA Gamma-glutamyltranspeptidase OS=Bacillus subtilis subsp. natto GN=ggt PE=1 SV=1 31 482 4.0E-54
sp|Q99MZ4|GGT7_RAT Gamma-glutamyltransferase 7 OS=Rattus norvegicus GN=Ggt7 PE=1 SV=2 33 514 4.0E-48
sp|Q9UJ14|GGT7_HUMAN Gamma-glutamyltransferase 7 OS=Homo sapiens GN=GGT7 PE=1 SV=2 33 514 7.0E-48
sp|Q0V8L2|GGT7_BOVIN Gamma-glutamyltransferase 7 OS=Bos taurus GN=GGT7 PE=2 SV=1 33 514 1.0E-46
sp|Q99JP7|GGT7_MOUSE Gamma-glutamyltransferase 7 OS=Mus musculus GN=Ggt7 PE=1 SV=2 33 514 2.0E-46
sp|Q9QWE9|GGT5_RAT Gamma-glutamyltransferase 5 OS=Rattus norvegicus GN=Ggt5 PE=2 SV=1 34 499 4.0E-46
sp|Q9Z2A9|GGT5_MOUSE Gamma-glutamyltransferase 5 OS=Mus musculus GN=Ggt5 PE=1 SV=2 34 499 3.0E-43
sp|Q9BX51|GGTL1_HUMAN Gamma-glutamyltransferase light chain 1 OS=Homo sapiens GN=GGTLC1 PE=2 SV=2 321 540 8.0E-41
sp|P36269|GGT5_HUMAN Gamma-glutamyltransferase 5 OS=Homo sapiens GN=GGT5 PE=1 SV=2 38 512 2.0E-40
sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1 321 515 2.0E-37
sp|Q9CAR5|GAGT4_ARATH Putative inactive gamma-glutamyltranspeptidase 4 OS=Arabidopsis thaliana GN=GGT4 PE=5 SV=1 305 493 1.0E-36
sp|Q14390|GGTL2_HUMAN Gamma-glutamyltransferase light chain 2 OS=Homo sapiens GN=GGTLC2 PE=2 SV=4 321 515 2.0E-32
sp|Q51693|CAPD_BACAN Capsule biosynthesis protein CapD OS=Bacillus anthracis GN=capD PE=1 SV=2 46 454 1.0E-31
sp|P74181|GGT_SYNY3 Gamma-glutamyltranspeptidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ggt PE=3 SV=1 33 540 3.0E-30
sp|O05218|YWRD_BACSU Putative gamma-glutamyltransferase YwrD OS=Bacillus subtilis (strain 168) GN=ywrD PE=1 SV=1 41 539 7.0E-30
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6050
MTPYPVRWVVRLLAASELLRTVVGASNEEAKLGAVACESAVCSRIGTQLLQSGGSAADAMVGTVLCVGTVAMYHS
GIGGGGFMTIRAADGQYETVDFREMAPAAAFEDMYKNKTDASIIGGLARKYGKLDWARVLEPAIHLARYGFVVTE
DLVRQMDSASDPLPFLTDDAAWAVDFAPGGRRVQLGEVMTRKRYADTLETVAKQGVEAFYSGPMAQATIAALRSR
NGTMTMADLANYTLVHRQPVHIDYHGVRLTSCNAPSGGIVALSALNILSNYDHLGDGAQFNLTTHRMDEAIKFAY
GQRTKLGDPSFVDVANLTAAMVSAEHGAHLRTRISDVTTQHLPWYDPDGFESIDTPGTSHLVAADASGLAISLTT
TVNLIFGSRVMVPETGVVMNNQMNDFSIPGVSNGFGYIPSPSNYIRPGKRPLSSISPIIAETADGKLLFSIGAAG
GSRITTATIQNTIHLLDRHMSMVETLRQPRLHDQLVPTVVTFEYTFNNDTVAFMKSLRHNVTWVAPGQSAAQGLR
LLPNGTFEAAGEPRQMASGGFAV
Coding >Ophio5|6050
ATGACGCCATACCCTGTAAGATGGGTGGTCAGGCTTCTCGCTGCCTCCGAGTTGTTGAGGACGGTGGTCGGGGCC
AGTAATGAAGAAGCGAAGCTCGGCGCCGTCGCCTGTGAGAGCGCCGTCTGCAGCCGGATCGGCACGCAACTGCTA
CAGAGCGGAGGCAGCGCAGCCGATGCCATGGTCGGTACTGTCTTGTGTGTCGGCACCGTGGCCATGTATCATAGC
GGCATCGGCGGCGGCGGCTTCATGACGATACGTGCAGCCGACGGACAGTACGAGACGGTGGATTTCCGAGAGATG
GCACCGGCTGCTGCCTTTGAGGACATGTACAAGAATAAGACGGATGCCAGCATCATCGGAGGTCTGGCTAGGAAA
TACGGCAAACTAGACTGGGCTCGAGTCTTGGAGCCGGCGATTCATCTCGCTCGCTACGGCTTCGTCGTGACTGAA
GACCTCGTCCGCCAGATGGATTCAGCGTCCGACCCCTTGCCCTTTTTAACCGACGACGCAGCCTGGGCCGTGGAC
TTTGCTCCGGGGGGACGGAGAGTACAGCTGGGAGAGGTGATGACGCGTAAGCGTTACGCCGATACGCTCGAGACG
GTGGCCAAGCAAGGCGTCGAAGCCTTCTACTCGGGGCCCATGGCCCAGGCCACCATCGCCGCTCTTCGCTCTCGT
AACGGGACCATGACCATGGCCGACCTGGCCAACTACACGCTCGTACACCGGCAGCCAGTTCACATCGACTACCAC
GGCGTACGTCTGACCAGCTGCAACGCGCCGTCTGGTGGGATAGTGGCACTGAGCGCGCTCAACATCCTCAGCAAC
TACGACCATCTCGGGGACGGAGCGCAGTTCAATCTGACTACGCACCGAATGGACGAGGCCATCAAGTTCGCCTAC
GGCCAGCGCACCAAACTCGGCGACCCGTCCTTCGTCGACGTGGCCAACTTGACGGCGGCCATGGTCTCGGCCGAG
CACGGCGCCCATCTTCGCACCCGCATATCCGACGTTACCACGCAGCATCTGCCTTGGTACGACCCGGACGGATTC
GAGTCCATCGACACGCCTGGAACCTCTCATCTTGTCGCGGCCGATGCGAGCGGTCTGGCCATATCGCTTACCACG
ACCGTCAATCTCATCTTCGGCTCCCGCGTCATGGTGCCTGAAACGGGCGTGGTGATGAACAACCAGATGAACGAC
TTTAGCATCCCCGGCGTGAGTAATGGCTTCGGCTACATCCCGAGTCCCTCCAACTACATCCGACCGGGCAAGCGG
CCACTATCATCCATCTCGCCCATCATCGCCGAGACGGCCGACGGCAAGTTGCTCTTCAGTATCGGAGCGGCCGGT
GGTAGCCGCATCACGACAGCCACCATCCAAAACACCATACACTTGCTGGATCGACACATGAGCATGGTCGAGACG
CTGAGACAGCCACGGCTACATGATCAGCTGGTCCCCACCGTGGTTACGTTTGAGTACACCTTCAACAACGACACG
GTTGCCTTTATGAAGTCGCTCCGTCACAATGTCACCTGGGTCGCTCCGGGTCAGAGCGCCGCCCAGGGTCTACGT
CTGCTGCCCAACGGGACCTTTGAGGCGGCGGGTGAGCCGAGGCAAATGGCCTCGGGAGGCTTTGCTGTC
Transcript >Ophio5|6050
ATGACGCCATACCCTGTAAGATGGGTGGTCAGGCTTCTCGCTGCCTCCGAGTTGTTGAGGACGGTGGTCGGGGCC
AGTAATGAAGAAGCGAAGCTCGGCGCCGTCGCCTGTGAGAGCGCCGTCTGCAGCCGGATCGGCACGCAACTGCTA
CAGAGCGGAGGCAGCGCAGCCGATGCCATGGTCGGTACTGTCTTGTGTGTCGGCACCGTGGCCATGTATCATAGC
GGCATCGGCGGCGGCGGCTTCATGACGATACGTGCAGCCGACGGACAGTACGAGACGGTGGATTTCCGAGAGATG
GCACCGGCTGCTGCCTTTGAGGACATGTACAAGAATAAGACGGATGCCAGCATCATCGGAGGTCTGGCTAGGAAA
TACGGCAAACTAGACTGGGCTCGAGTCTTGGAGCCGGCGATTCATCTCGCTCGCTACGGCTTCGTCGTGACTGAA
GACCTCGTCCGCCAGATGGATTCAGCGTCCGACCCCTTGCCCTTTTTAACCGACGACGCAGCCTGGGCCGTGGAC
TTTGCTCCGGGGGGACGGAGAGTACAGCTGGGAGAGGTGATGACGCGTAAGCGTTACGCCGATACGCTCGAGACG
GTGGCCAAGCAAGGCGTCGAAGCCTTCTACTCGGGGCCCATGGCCCAGGCCACCATCGCCGCTCTTCGCTCTCGT
AACGGGACCATGACCATGGCCGACCTGGCCAACTACACGCTCGTACACCGGCAGCCAGTTCACATCGACTACCAC
GGCGTACGTCTGACCAGCTGCAACGCGCCGTCTGGTGGGATAGTGGCACTGAGCGCGCTCAACATCCTCAGCAAC
TACGACCATCTCGGGGACGGAGCGCAGTTCAATCTGACTACGCACCGAATGGACGAGGCCATCAAGTTCGCCTAC
GGCCAGCGCACCAAACTCGGCGACCCGTCCTTCGTCGACGTGGCCAACTTGACGGCGGCCATGGTCTCGGCCGAG
CACGGCGCCCATCTTCGCACCCGCATATCCGACGTTACCACGCAGCATCTGCCTTGGTACGACCCGGACGGATTC
GAGTCCATCGACACGCCTGGAACCTCTCATCTTGTCGCGGCCGATGCGAGCGGTCTGGCCATATCGCTTACCACG
ACCGTCAATCTCATCTTCGGCTCCCGCGTCATGGTGCCTGAAACGGGCGTGGTGATGAACAACCAGATGAACGAC
TTTAGCATCCCCGGCGTGAGTAATGGCTTCGGCTACATCCCGAGTCCCTCCAACTACATCCGACCGGGCAAGCGG
CCACTATCATCCATCTCGCCCATCATCGCCGAGACGGCCGACGGCAAGTTGCTCTTCAGTATCGGAGCGGCCGGT
GGTAGCCGCATCACGACAGCCACCATCCAAAACACCATACACTTGCTGGATCGACACATGAGCATGGTCGAGACG
CTGAGACAGCCACGGCTACATGATCAGCTGGTCCCCACCGTGGTTACGTTTGAGTACACCTTCAACAACGACACG
GTTGCCTTTATGAAGTCGCTCCGTCACAATGTCACCTGGGTCGCTCCGGGTCAGAGCGCCGCCCAGGGTCTACGT
CTGCTGCCCAACGGGACCTTTGAGGCGGCGGGTGAGCCGAGGCAAATGGCCTCGGGAGGCTTTGCTGTCTGA
Gene >Ophio5|6050
ATGACGCCATACCCTGTAAGATGGGTGGTCAGGCTTCTCGCTGCCTCCGAGTTGTTGAGGACGGTGGTCGGGGCC
AGTAATGAAGAAGCGAAGCTCGGCGCCGTCGCCTGTGAGAGCGCCGTCTGCAGCCGGATCGGCACGCAACTGCTA
CAGAGCGGAGGCAGCGCAGCCGATGCCATGGTCGGTACTGTCTTGTGTGTCGGCACCGTGGCCATGTATCATAGC
GGCATCGGCGGCGGCGGCTTCATGACGATACGTGCAGCCGACGGACAGTACGAGACGGTGGATTTCCGAGAGATG
GCACCGGCTGCTGCCTTTGAGGACATGTACAAGAATAAGACGGATGCCAGCATCATCGGAGGTCTGGCTAGGTAC
AGCAGCACTTTTTGCCCTGATGATGATGATGATGATGATGATGATGATGATGAGGCTTTTCGCTAATCGTGCTCC
TCTCCCCCAAACAGTGGCGTTCCAGGGGAGCTGAGGGGACTGGAATACCTTCACAGGAAATACGGCAAACTAGAC
TGGGCTCGAGTCTTGGAGCCGGCGATTCATCTCGCTCGCTACGGCTTCGTCGTGACTGAAGACCTCGTCCGCCAG
ATGGATTCAGCGTCCGACCCCTTGCCCTTTTTAACCGACGACGCAGCCTGGGCCGTGGACTTTGCTCCGGGGGGA
CGGAGAGTACAGCTGGGAGAGGTGATGACGCGTAAGCGTTACGCCGATACGCTCGAGACGGTGGCCAAGCAAGGC
GTCGAAGCCTTCTACTCGGGGCCCATGGCCCAGGCCACCATCGCCGCTCTTCGCTCTCGTAACGGGACCATGACC
ATGGCCGACCTGGCCAACTACACGCTCGTACACCGGCAGCCAGTTCACATCGACTACCACGGCGTACGTCTGACC
AGCTGCAACGCGCCGTCTGGTGGGATAGTGGCACTGAGCGCGCTCAACATCCTCAGCAACTACGACCATCTCGGG
GACGGAGCGCAGTTCAATCTGACTACGCACCGAATGGACGAGGCCATCAAGTTCGCCTACGGCCAGCGCACCAAA
CTCGGCGACCCGTCCTTCGTCGACGTGGCCAACTTGACGGCGGCCATGGTCTCGGCCGAGCACGGCGCCCATCTT
CGCACCCGCATATCCGACGTTACCACGCAGCATCTGCCTTGGTACGACCCGGACGGATTCGAGTCCATCGACACG
CCTGGAACCTCTCATCTTGTCGCGGCCGATGCGAGCGGTCTGGCCATATCGCTTACCACGACCGTCAATCTCATC
TTCGGCTCCCGCGTCATGGTGCCTGAAACGGGCGTGGTGATGAACAACCAGATGAACGACTTTAGCATCCCCGGC
GTGAGTAATGGCTTCGGCTACATCCCGAGTCCCTCCAACTACATCCGACCGGGCAAGCGGCCACTATCATCCATC
TCGCCCATCATCGCCGAGACGGCCGACGGCAAGTTGCTCTTCAGTATCGGAGCGGCCGGTGGTAGCCGCATCACG
ACAGCCACCATCCAAAACACCATACACTTGCTGGATCGACACATGAGCATGGTCGAGACGCTGAGACAGCCACGG
CTACATGATCAGCTGGTCCCCACCGTGGTTACGTTTGAGTACACCTTCAACAACGACACGGTTGCCTTTATGAAG
TCGCTCCGTCACAATGTCACCTGGGTCGCTCCGGGTCAGAGCGCCGCCCAGGGTCTACGTCTGCTGCCCAACGGG
ACCTTTGAGGCGGCGGGTGAGCCGAGGCAAATGGCCTCGGGAGGCTTTGCTGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail