Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6048
Gene name
Locationscaffold_51:48290..50899
Strand+
Gene length (bp)2609
Transcript length (bp)2529
Coding sequence length (bp)2526
Protein length (aa) 842

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08553 VID27 VID27 C-terminal WD40-like domain 1.6E-185 438 793
PF17748 VID27_N VID27 N-terminal region 8.4E-71 1 176
PF17747 VID27_PH VID27 PH-like domain 1.8E-40 254 361

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR3|VID27_SCHPO Vacuolar import and degradation protein 27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vid27 PE=1 SV=1 1 793 0.0E+00
sp|P40157|VID27_YEAST Vacuolar import and degradation protein 27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VID27 PE=1 SV=1 6 793 7.0E-142
sp|Q555V7|VID27_DICDI VID27-like protein OS=Dictyostelium discoideum GN=DDB_G0274813 PE=3 SV=1 439 782 4.0E-59
sp|P40781|CYPR4_CYNCA Protein CYPRO4 OS=Cynara cardunculus GN=CYPRO4 PE=2 SV=1 427 736 6.0E-27

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6048
MFVLRNVGKLIFGSSAQESLIDLPQGQLYLVRPLSPKGYSELIFKDAAVRIRRTNQDFHYQLVVQRVFEEGEAEL
LADEEGEEAEIDALEAERDEKTFLIDEALHLRIDIRPSGEKVLAWRDLSGDTGDLYEFVCDTHVPSSLVERFIKT
ARECQFERKYRRPQATAFPEDLHQFEFDEEPPIPPASPLHSPTLARSIDSVDDMYKQKTAANSSAKRGGGTTAPE
PASVPGRGSADSTPPRKAAAAALPPQPIEIYATVTAELHLFEPQPGHFAMVDDEVIATVSEVGKWEYWLQIDGKG
KSWLGAPVVAEFNPVFDFEYLSFVFNHFTDDGMARSWLLRFKDQPTLEKFQQAVMQAIWEKLNETKWAKIKEKER
EYVLDSFGDLTMEDAPPPEEEEEEEGEEEEREEDEDDEQGIHSQVYDSEDDEAAEEERKGGEVNSQLAVGYKHDR
SFVVRGSKIGVFSHTPDNRLKFSTNISKVTTPSGRLMSPKKVMLHSEDRDLIMQNETDANKLFRMDIEYGKVVDE
WKVHDDVPVVTFAPENKFAQMTSEQTFLGVSGNALYRIDPRLSGNKLVDSDMKQYASKNDFSALATTEKGYIAVA
SNKGDIRLFDRLGIRAKTQLPALGDAIIGMDVSADGRWILGTTKNYLLLVDAKQKDGKHEGKLGFEQPFSANSKP
QPRRLALTPEHVAQFYHETGQPVSFTPAKFNTGEGAEETSIITATGPYIVEWSLKRVLQGGGGGGGKGSAYRIKR
YEDDVKADDFKFGSDKNVIVALPNEVNMVAKRALRRPTRESIMGGGGGGRLSGGGGGGRRSDARYIGGGGGGADG
GRRYNKLGKDDIVNSPY
Coding >Ophio5|6048
ATGTTTGTTCTGCGAAACGTTGGCAAGCTGATCTTCGGCTCGAGCGCTCAGGAATCGCTCATCGACCTGCCCCAG
GGCCAACTCTACCTCGTCCGCCCTCTCTCCCCCAAGGGCTATTCGGAGCTCATCTTCAAGGACGCCGCTGTCCGC
ATCCGCCGCACCAATCAAGACTTTCACTATCAGCTCGTCGTCCAACGCGTCTTCGAAGAGGGCGAGGCGGAGCTG
CTGGCCGACGAGGAGGGCGAAGAGGCCGAGATTGATGCGCTCGAGGCCGAACGCGACGAAAAGACGTTTTTGATC
GACGAGGCCCTGCATCTCAGAATCGACATTCGCCCGAGCGGCGAGAAGGTTCTGGCCTGGAGGGACCTGAGCGGC
GACACGGGCGATCTCTACGAGTTTGTCTGCGATACACACGTTCCTTCTTCCCTTGTCGAACGCTTCATCAAGACG
GCTCGCGAGTGTCAGTTCGAGCGCAAGTACCGCCGGCCACAGGCGACAGCCTTCCCTGAGGATCTGCACCAGTTC
GAGTTCGACGAGGAACCTCCGATTCCGCCGGCAAGCCCTCTGCACAGCCCGACCTTGGCCCGCTCCATCGATTCC
GTCGACGACATGTACAAGCAAAAGACGGCGGCCAATTCGTCGGCCAAGCGAGGGGGGGGCACGACGGCGCCCGAG
CCCGCGTCCGTCCCCGGTCGTGGCTCGGCCGACTCGACGCCGCCTCGTAAGGCAGCCGCTGCGGCACTACCTCCC
CAACCCATCGAGATCTATGCTACCGTCACGGCGGAGCTGCATCTCTTTGAGCCGCAGCCCGGCCACTTTGCCATG
GTCGACGATGAAGTCATCGCCACCGTCTCCGAAGTCGGCAAGTGGGAGTATTGGCTGCAGATCGACGGCAAAGGC
AAGTCTTGGCTGGGAGCGCCCGTCGTGGCCGAGTTCAATCCTGTCTTCGACTTTGAGTACCTGTCCTTTGTCTTC
AACCACTTCACCGACGATGGCATGGCGAGGTCGTGGCTGCTTCGTTTCAAGGACCAGCCGACACTGGAAAAGTTC
CAGCAGGCCGTGATGCAGGCCATCTGGGAGAAGTTGAACGAGACGAAATGGGCCAAGATCAAGGAAAAGGAGCGA
GAGTACGTTCTCGACTCGTTCGGAGACCTGACCATGGAAGATGCGCCCCCTCCGGAAGAAGAAGAAGAAGAAGAA
GGAGAAGAGGAAGAGCGTGAGGAAGACGAGGACGACGAGCAAGGCATCCACAGCCAAGTCTACGACTCGGAAGAC
GACGAGGCCGCCGAGGAAGAGAGGAAGGGAGGCGAAGTCAACTCGCAGCTGGCCGTCGGCTACAAGCACGACCGC
TCGTTTGTTGTCCGAGGCTCCAAGATCGGCGTCTTCTCCCACACGCCTGACAACCGGCTGAAGTTCTCGACCAAT
ATTTCCAAGGTGACGACTCCCAGCGGAAGACTGATGAGCCCCAAGAAGGTCATGTTGCACAGCGAGGACCGCGAC
CTCATCATGCAGAACGAGACGGATGCCAACAAGCTCTTCCGCATGGACATCGAATACGGCAAGGTGGTGGACGAG
TGGAAGGTGCACGACGACGTGCCCGTCGTCACGTTTGCGCCCGAGAACAAGTTTGCGCAGATGACGTCGGAGCAG
ACGTTCCTGGGCGTGTCGGGCAACGCCCTGTACCGCATCGACCCGCGCCTGTCGGGCAACAAGCTCGTCGACTCG
GACATGAAGCAGTACGCGTCCAAGAACGACTTCTCGGCCCTGGCGACGACGGAAAAGGGCTACATCGCCGTGGCC
AGCAACAAGGGAGACATCCGGCTCTTCGACCGGCTCGGCATCCGGGCCAAGACGCAGCTCCCCGCGCTGGGCGAC
GCCATCATCGGCATGGACGTGTCGGCGGACGGGCGCTGGATCCTCGGCACCACCAAGAACTACCTACTGCTCGTC
GACGCCAAGCAAAAGGACGGCAAGCACGAGGGCAAGCTCGGCTTCGAGCAGCCCTTTTCGGCCAACTCGAAGCCC
CAGCCGCGAAGGCTCGCCCTCACGCCGGAACACGTGGCCCAGTTTTACCACGAGACGGGCCAACCGGTCTCCTTT
ACGCCGGCCAAGTTCAACACGGGCGAGGGCGCCGAGGAGACGAGCATCATCACGGCCACGGGGCCGTACATTGTC
GAATGGAGCCTCAAGCGCGTCCTTCAGGGCGGCGGCGGCGGCGGCGGCAAGGGAAGCGCATACCGTATCAAGCGG
TACGAAGACGACGTCAAGGCGGACGACTTCAAGTTCGGGTCGGACAAGAACGTCATCGTCGCCCTGCCCAACGAG
GTCAACATGGTGGCCAAGCGTGCGCTGCGCCGCCCCACGCGCGAGTCCATCATGGGCGGCGGCGGCGGCGGTAGG
CTTAGCGGTGGTGGTGGTGGTGGTCGTCGGTCTGACGCTAGGTATATCGGCGGCGGCGGCGGCGGCGCTGATGGT
GGGAGGAGGTATAATAAGCTCGGTAAGGACGACATTGTCAATTCTCCGTAT
Transcript >Ophio5|6048
ATGTTTGTTCTGCGAAACGTTGGCAAGCTGATCTTCGGCTCGAGCGCTCAGGAATCGCTCATCGACCTGCCCCAG
GGCCAACTCTACCTCGTCCGCCCTCTCTCCCCCAAGGGCTATTCGGAGCTCATCTTCAAGGACGCCGCTGTCCGC
ATCCGCCGCACCAATCAAGACTTTCACTATCAGCTCGTCGTCCAACGCGTCTTCGAAGAGGGCGAGGCGGAGCTG
CTGGCCGACGAGGAGGGCGAAGAGGCCGAGATTGATGCGCTCGAGGCCGAACGCGACGAAAAGACGTTTTTGATC
GACGAGGCCCTGCATCTCAGAATCGACATTCGCCCGAGCGGCGAGAAGGTTCTGGCCTGGAGGGACCTGAGCGGC
GACACGGGCGATCTCTACGAGTTTGTCTGCGATACACACGTTCCTTCTTCCCTTGTCGAACGCTTCATCAAGACG
GCTCGCGAGTGTCAGTTCGAGCGCAAGTACCGCCGGCCACAGGCGACAGCCTTCCCTGAGGATCTGCACCAGTTC
GAGTTCGACGAGGAACCTCCGATTCCGCCGGCAAGCCCTCTGCACAGCCCGACCTTGGCCCGCTCCATCGATTCC
GTCGACGACATGTACAAGCAAAAGACGGCGGCCAATTCGTCGGCCAAGCGAGGGGGGGGCACGACGGCGCCCGAG
CCCGCGTCCGTCCCCGGTCGTGGCTCGGCCGACTCGACGCCGCCTCGTAAGGCAGCCGCTGCGGCACTACCTCCC
CAACCCATCGAGATCTATGCTACCGTCACGGCGGAGCTGCATCTCTTTGAGCCGCAGCCCGGCCACTTTGCCATG
GTCGACGATGAAGTCATCGCCACCGTCTCCGAAGTCGGCAAGTGGGAGTATTGGCTGCAGATCGACGGCAAAGGC
AAGTCTTGGCTGGGAGCGCCCGTCGTGGCCGAGTTCAATCCTGTCTTCGACTTTGAGTACCTGTCCTTTGTCTTC
AACCACTTCACCGACGATGGCATGGCGAGGTCGTGGCTGCTTCGTTTCAAGGACCAGCCGACACTGGAAAAGTTC
CAGCAGGCCGTGATGCAGGCCATCTGGGAGAAGTTGAACGAGACGAAATGGGCCAAGATCAAGGAAAAGGAGCGA
GAGTACGTTCTCGACTCGTTCGGAGACCTGACCATGGAAGATGCGCCCCCTCCGGAAGAAGAAGAAGAAGAAGAA
GGAGAAGAGGAAGAGCGTGAGGAAGACGAGGACGACGAGCAAGGCATCCACAGCCAAGTCTACGACTCGGAAGAC
GACGAGGCCGCCGAGGAAGAGAGGAAGGGAGGCGAAGTCAACTCGCAGCTGGCCGTCGGCTACAAGCACGACCGC
TCGTTTGTTGTCCGAGGCTCCAAGATCGGCGTCTTCTCCCACACGCCTGACAACCGGCTGAAGTTCTCGACCAAT
ATTTCCAAGGTGACGACTCCCAGCGGAAGACTGATGAGCCCCAAGAAGGTCATGTTGCACAGCGAGGACCGCGAC
CTCATCATGCAGAACGAGACGGATGCCAACAAGCTCTTCCGCATGGACATCGAATACGGCAAGGTGGTGGACGAG
TGGAAGGTGCACGACGACGTGCCCGTCGTCACGTTTGCGCCCGAGAACAAGTTTGCGCAGATGACGTCGGAGCAG
ACGTTCCTGGGCGTGTCGGGCAACGCCCTGTACCGCATCGACCCGCGCCTGTCGGGCAACAAGCTCGTCGACTCG
GACATGAAGCAGTACGCGTCCAAGAACGACTTCTCGGCCCTGGCGACGACGGAAAAGGGCTACATCGCCGTGGCC
AGCAACAAGGGAGACATCCGGCTCTTCGACCGGCTCGGCATCCGGGCCAAGACGCAGCTCCCCGCGCTGGGCGAC
GCCATCATCGGCATGGACGTGTCGGCGGACGGGCGCTGGATCCTCGGCACCACCAAGAACTACCTACTGCTCGTC
GACGCCAAGCAAAAGGACGGCAAGCACGAGGGCAAGCTCGGCTTCGAGCAGCCCTTTTCGGCCAACTCGAAGCCC
CAGCCGCGAAGGCTCGCCCTCACGCCGGAACACGTGGCCCAGTTTTACCACGAGACGGGCCAACCGGTCTCCTTT
ACGCCGGCCAAGTTCAACACGGGCGAGGGCGCCGAGGAGACGAGCATCATCACGGCCACGGGGCCGTACATTGTC
GAATGGAGCCTCAAGCGCGTCCTTCAGGGCGGCGGCGGCGGCGGCGGCAAGGGAAGCGCATACCGTATCAAGCGG
TACGAAGACGACGTCAAGGCGGACGACTTCAAGTTCGGGTCGGACAAGAACGTCATCGTCGCCCTGCCCAACGAG
GTCAACATGGTGGCCAAGCGTGCGCTGCGCCGCCCCACGCGCGAGTCCATCATGGGCGGCGGCGGCGGCGGTAGG
CTTAGCGGTGGTGGTGGTGGTGGTCGTCGGTCTGACGCTAGGTATATCGGCGGCGGCGGCGGCGGCGCTGATGGT
GGGAGGAGGTATAATAAGCTCGGTAAGGACGACATTGTCAATTCTCCGTATTGA
Gene >Ophio5|6048
ATGTTTGTTCTGCGAAACGGTCAGTGCGATTTTTTTTTTTAGCCACTGCATGCCTCTCCGACCATTCCCCCGGCA
CGGCCGGCTAACCCGAACCACCAGTTGGCAAGCTGATCTTCGGCTCGAGCGCTCAGGAATCGCTCATCGACCTGC
CCCAGGGCCAACTCTACCTCGTCCGCCCTCTCTCCCCCAAGGGCTATTCGGAGCTCATCTTCAAGGACGCCGCTG
TCCGCATCCGCCGCACCAATCAAGACTTTCACTATCAGCTCGTCGTCCAACGCGTCTTCGAAGAGGGCGAGGCGG
AGCTGCTGGCCGACGAGGAGGGCGAAGAGGCCGAGATTGATGCGCTCGAGGCCGAACGCGACGAAAAGACGTTTT
TGATCGACGAGGCCCTGCATCTCAGAATCGACATTCGCCCGAGCGGCGAGAAGGTTCTGGCCTGGAGGGACCTGA
GCGGCGACACGGGCGATCTCTACGAGTTTGTCTGCGATACACACGTTCCTTCTTCCCTTGTCGAACGCTTCATCA
AGACGGCTCGCGAGTGTCAGTTCGAGCGCAAGTACCGCCGGCCACAGGCGACAGCCTTCCCTGAGGATCTGCACC
AGTTCGAGTTCGACGAGGAACCTCCGATTCCGCCGGCAAGCCCTCTGCACAGCCCGACCTTGGCCCGCTCCATCG
ATTCCGTCGACGACATGTACAAGCAAAAGACGGCGGCCAATTCGTCGGCCAAGCGAGGGGGGGGCACGACGGCGC
CCGAGCCCGCGTCCGTCCCCGGTCGTGGCTCGGCCGACTCGACGCCGCCTCGTAAGGCAGCCGCTGCGGCACTAC
CTCCCCAACCCATCGAGATCTATGCTACCGTCACGGCGGAGCTGCATCTCTTTGAGCCGCAGCCCGGCCACTTTG
CCATGGTCGACGATGAAGTCATCGCCACCGTCTCCGAAGTCGGCAAGTGGGAGTATTGGCTGCAGATCGACGGCA
AAGGCAAGTCTTGGCTGGGAGCGCCCGTCGTGGCCGAGTTCAATCCTGTCTTCGACTTTGAGTACCTGTCCTTTG
TCTTCAACCACTTCACCGACGATGGCATGGCGAGGTCGTGGCTGCTTCGTTTCAAGGACCAGCCGACACTGGAAA
AGTTCCAGCAGGCCGTGATGCAGGCCATCTGGGAGAAGTTGAACGAGACGAAATGGGCCAAGATCAAGGAAAAGG
AGCGAGAGTACGTTCTCGACTCGTTCGGAGACCTGACCATGGAAGATGCGCCCCCTCCGGAAGAAGAAGAAGAAG
AAGAAGGAGAAGAGGAAGAGCGTGAGGAAGACGAGGACGACGAGCAAGGCATCCACAGCCAAGTCTACGACTCGG
AAGACGACGAGGCCGCCGAGGAAGAGAGGAAGGGAGGCGAAGTCAACTCGCAGCTGGCCGTCGGCTACAAGCACG
ACCGCTCGTTTGTTGTCCGAGGCTCCAAGATCGGCGTCTTCTCCCACACGCCTGACAACCGGCTGAAGTTCTCGA
CCAATATTTCCAAGGTGACGACTCCCAGCGGAAGACTGATGAGCCCCAAGAAGGTCATGTTGCACAGCGAGGACC
GCGACCTCATCATGCAGAACGAGACGGATGCCAACAAGCTCTTCCGCATGGACATCGAATACGGCAAGGTGGTGG
ACGAGTGGAAGGTGCACGACGACGTGCCCGTCGTCACGTTTGCGCCCGAGAACAAGTTTGCGCAGATGACGTCGG
AGCAGACGTTCCTGGGCGTGTCGGGCAACGCCCTGTACCGCATCGACCCGCGCCTGTCGGGCAACAAGCTCGTCG
ACTCGGACATGAAGCAGTACGCGTCCAAGAACGACTTCTCGGCCCTGGCGACGACGGAAAAGGGCTACATCGCCG
TGGCCAGCAACAAGGGAGACATCCGGCTCTTCGACCGGCTCGGCATCCGGGCCAAGACGCAGCTCCCCGCGCTGG
GCGACGCCATCATCGGCATGGACGTGTCGGCGGACGGGCGCTGGATCCTCGGCACCACCAAGAACTACCTACTGC
TCGTCGACGCCAAGCAAAAGGACGGCAAGCACGAGGGCAAGCTCGGCTTCGAGCAGCCCTTTTCGGCCAACTCGA
AGCCCCAGCCGCGAAGGCTCGCCCTCACGCCGGAACACGTGGCCCAGTTTTACCACGAGACGGGCCAACCGGTCT
CCTTTACGCCGGCCAAGTTCAACACGGGCGAGGGCGCCGAGGAGACGAGCATCATCACGGCCACGGGGCCGTACA
TTGTCGAATGGAGCCTCAAGCGCGTCCTTCAGGGCGGCGGCGGCGGCGGCGGCAAGGGAAGCGCATACCGTATCA
AGCGGTACGAAGACGACGTCAAGGCGGACGACTTCAAGTTCGGGTCGGACAAGAACGTCATCGTCGCCCTGCCCA
ACGAGGTCAACATGGTGGCCAAGCGTGCGCTGCGCCGCCCCACGCGCGAGTCCATCATGGGCGGCGGCGGCGGCG
GTAGGCTTAGCGGTGGTGGTGGTGGTGGTCGTCGGTCTGACGCTAGGTATATCGGCGGCGGCGGCGGCGGCGCTG
ATGGTGGGAGGAGGTATAATAAGCTCGGTAAGGACGACATTGTCAATTCTCCGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail