Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6047
Gene name
Locationscaffold_51:45719..47549
Strand+
Gene length (bp)1830
Transcript length (bp)1635
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07156 Prenylcys_lyase Prenylcysteine lyase 5.3E-85 134 504
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.9E-13 27 91
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.0E-11 33 315

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P57681|PCYOX_ARATH Farnesylcysteine lyase OS=Arabidopsis thaliana GN=FLCY PE=1 SV=1 25 501 1.0E-28
sp|Q95KC9|PCYOX_MACFA Prenylcysteine oxidase OS=Macaca fascicularis GN=PCYOX1 PE=2 SV=1 24 500 6.0E-22
sp|Q99ML5|PCYOX_RAT Prenylcysteine oxidase OS=Rattus norvegicus GN=Pcyox1 PE=1 SV=1 23 500 2.0E-20
sp|Q9CQF9|PCYOX_MOUSE Prenylcysteine oxidase OS=Mus musculus GN=Pcyox1 PE=1 SV=1 25 500 2.0E-20
sp|Q5R748|PCYOX_PONAB Prenylcysteine oxidase OS=Pongo abelii GN=PCYOX1 PE=2 SV=1 35 500 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P57681|PCYOX_ARATH Farnesylcysteine lyase OS=Arabidopsis thaliana GN=FLCY PE=1 SV=1 25 501 1.0E-28
sp|Q95KC9|PCYOX_MACFA Prenylcysteine oxidase OS=Macaca fascicularis GN=PCYOX1 PE=2 SV=1 24 500 6.0E-22
sp|Q99ML5|PCYOX_RAT Prenylcysteine oxidase OS=Rattus norvegicus GN=Pcyox1 PE=1 SV=1 23 500 2.0E-20
sp|Q9CQF9|PCYOX_MOUSE Prenylcysteine oxidase OS=Mus musculus GN=Pcyox1 PE=1 SV=1 25 500 2.0E-20
sp|Q5R748|PCYOX_PONAB Prenylcysteine oxidase OS=Pongo abelii GN=PCYOX1 PE=2 SV=1 35 500 4.0E-18
sp|Q9UHG3|PCYOX_HUMAN Prenylcysteine oxidase 1 OS=Homo sapiens GN=PCYOX1 PE=1 SV=3 35 500 1.0E-17
sp|Q0P5H1|PCYXL_BOVIN Prenylcysteine oxidase-like OS=Bos taurus GN=PCYOX1L PE=2 SV=1 24 500 2.0E-15
sp|Q8C7K6|PCYXL_MOUSE Prenylcysteine oxidase-like OS=Mus musculus GN=Pcyox1l PE=1 SV=1 11 500 8.0E-11
sp|Q8NBM8|PCYXL_HUMAN Prenylcysteine oxidase-like OS=Homo sapiens GN=PCYOX1L PE=1 SV=2 24 500 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0030328 prenylcysteine catabolic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor Yes
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0042219 cellular modified amino acid catabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0009056 catabolic process No
GO:0030329 prenylcysteine metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:1901575 organic substance catabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6047
MRLRLGFVLGLAAAVAGRGADVKNVAIVGAGAAGSSAAYYLAKYARQEGLAINTTVFEKTDRIGGRTLTVDAFDD
PAQRVELGASIFVGVNHIMYNATRTFGLSLADVDGSEDGDVTLIWDGESVLFRSVEGTSWWWDAARLWWRYGTAP
YRALKLVRRVISVFLKLYDEPYFPFRSLTRRAYELGLNEVTALTGEQFLAKNKIDADFARHLMQPATRVNYASNL
AYIHGLEAMVSFATEGAMSVQGGNWQIFDHMARSSGAAIRRNTSVTAISLEKGMMKPGAPRKYLLSTRETGASSA
TSYPVSFDNVIVATPWQFSDMEAEEGVLKQDIDEIPYMKLHVTLFTSPFALRAEYFNLEGGIKPPSNVYTTLGKH
EQPRPGPEGVGRTGFYSISTLRRVTNPKTLEREYLYKIFSVSAVTPQFLADILGAEVPSTFVSPTGTATISWYYP
HWFYSYPIELPRVTFQDPVIGRGLFYTSGVESFISTMETSALMGMNVARLVADECPGWSRARTAAADGGRRAMRE
DFFVRVESEVGGMMMQDEL
Coding >Ophio5|6047
ATGCGATTGCGGCTGGGCTTTGTCTTGGGTCTGGCAGCGGCGGTGGCTGGGCGGGGTGCGGATGTGAAGAATGTC
GCTATCGTTGGCGCCGGAGCCGCTGGCTCATCAGCAGCCTACTACCTAGCCAAATACGCCCGGCAAGAAGGCCTC
GCCATCAACACAACCGTGTTCGAGAAAACGGACCGCATCGGCGGACGAACCCTCACCGTCGACGCCTTCGATGAT
CCGGCCCAGCGCGTCGAGCTGGGTGCTTCCATCTTCGTCGGCGTCAACCACATCATGTACAATGCCACCCGCACC
TTTGGTCTCTCGCTCGCAGACGTCGATGGCTCCGAGGACGGCGACGTGACACTCATCTGGGACGGCGAGAGCGTG
CTCTTCCGTTCCGTCGAGGGAACCTCGTGGTGGTGGGACGCGGCCAGGCTGTGGTGGCGTTATGGCACTGCGCCG
TATAGGGCGCTGAAGCTCGTTCGCCGCGTCATTTCCGTCTTCTTGAAGCTCTATGATGAGCCTTATTTCCCGTTC
CGGTCTTTGACGAGGAGGGCGTATGAGCTGGGGTTGAATGAGGTTACGGCTCTGACGGGCGAGCAGTTTCTTGCC
AAGAACAAGATCGACGCCGACTTCGCTCGCCATCTTATGCAGCCCGCCACGCGTGTCAACTACGCTTCCAACCTG
GCCTACATCCACGGCCTCGAGGCCATGGTCTCCTTCGCCACCGAAGGAGCCATGTCCGTGCAGGGCGGAAACTGG
CAGATCTTCGACCACATGGCCCGTAGCAGCGGAGCCGCCATCCGCCGCAACACGTCCGTCACGGCCATCTCGCTC
GAGAAAGGCATGATGAAGCCCGGGGCGCCGAGGAAGTATCTCCTTTCAACGCGGGAGACGGGCGCGTCGTCGGCG
ACCTCGTACCCGGTCAGCTTCGACAACGTCATCGTCGCGACGCCGTGGCAATTCAGCGACATGGAGGCCGAAGAG
GGCGTGCTCAAGCAGGACATTGACGAGATTCCGTACATGAAGCTTCATGTCACGCTCTTTACCTCGCCTTTTGCC
CTGAGGGCCGAATACTTTAACCTCGAAGGCGGGATCAAGCCGCCCAGCAACGTGTATACGACACTCGGCAAGCAC
GAGCAGCCGAGGCCAGGGCCCGAGGGCGTGGGCCGAACGGGCTTCTACTCCATCAGCACGCTGCGGAGGGTGACG
AACCCCAAGACGCTGGAGAGGGAGTACCTCTACAAGATCTTCTCCGTCTCGGCGGTGACGCCGCAGTTCTTGGCC
GACATCTTGGGCGCCGAAGTGCCGAGCACGTTTGTCTCGCCGACGGGGACAGCGACCATCTCATGGTACTACCCG
CACTGGTTCTACTCGTACCCGATCGAGCTTCCGCGCGTGACGTTCCAGGACCCCGTCATAGGGCGCGGCCTGTTC
TACACTTCGGGCGTGGAGAGCTTCATCTCGACCATGGAGACGAGCGCGCTCATGGGCATGAACGTCGCTCGGCTC
GTCGCCGACGAGTGTCCGGGTTGGTCGAGGGCGAGGACGGCGGCTGCGGATGGGGGGAGGCGAGCAATGAGGGAG
GATTTCTTCGTTCGGGTTGAGAGTGAGGTTGGTGGGATGATGATGCAGGATGAGTTG
Transcript >Ophio5|6047
ATGCGATTGCGGCTGGGCTTTGTCTTGGGTCTGGCAGCGGCGGTGGCTGGGCGGGGTGCGGATGTGAAGAATGTC
GCTATCGTTGGCGCCGGAGCCGCTGGCTCATCAGCAGCCTACTACCTAGCCAAATACGCCCGGCAAGAAGGCCTC
GCCATCAACACAACCGTGTTCGAGAAAACGGACCGCATCGGCGGACGAACCCTCACCGTCGACGCCTTCGATGAT
CCGGCCCAGCGCGTCGAGCTGGGTGCTTCCATCTTCGTCGGCGTCAACCACATCATGTACAATGCCACCCGCACC
TTTGGTCTCTCGCTCGCAGACGTCGATGGCTCCGAGGACGGCGACGTGACACTCATCTGGGACGGCGAGAGCGTG
CTCTTCCGTTCCGTCGAGGGAACCTCGTGGTGGTGGGACGCGGCCAGGCTGTGGTGGCGTTATGGCACTGCGCCG
TATAGGGCGCTGAAGCTCGTTCGCCGCGTCATTTCCGTCTTCTTGAAGCTCTATGATGAGCCTTATTTCCCGTTC
CGGTCTTTGACGAGGAGGGCGTATGAGCTGGGGTTGAATGAGGTTACGGCTCTGACGGGCGAGCAGTTTCTTGCC
AAGAACAAGATCGACGCCGACTTCGCTCGCCATCTTATGCAGCCCGCCACGCGTGTCAACTACGCTTCCAACCTG
GCCTACATCCACGGCCTCGAGGCCATGGTCTCCTTCGCCACCGAAGGAGCCATGTCCGTGCAGGGCGGAAACTGG
CAGATCTTCGACCACATGGCCCGTAGCAGCGGAGCCGCCATCCGCCGCAACACGTCCGTCACGGCCATCTCGCTC
GAGAAAGGCATGATGAAGCCCGGGGCGCCGAGGAAGTATCTCCTTTCAACGCGGGAGACGGGCGCGTCGTCGGCG
ACCTCGTACCCGGTCAGCTTCGACAACGTCATCGTCGCGACGCCGTGGCAATTCAGCGACATGGAGGCCGAAGAG
GGCGTGCTCAAGCAGGACATTGACGAGATTCCGTACATGAAGCTTCATGTCACGCTCTTTACCTCGCCTTTTGCC
CTGAGGGCCGAATACTTTAACCTCGAAGGCGGGATCAAGCCGCCCAGCAACGTGTATACGACACTCGGCAAGCAC
GAGCAGCCGAGGCCAGGGCCCGAGGGCGTGGGCCGAACGGGCTTCTACTCCATCAGCACGCTGCGGAGGGTGACG
AACCCCAAGACGCTGGAGAGGGAGTACCTCTACAAGATCTTCTCCGTCTCGGCGGTGACGCCGCAGTTCTTGGCC
GACATCTTGGGCGCCGAAGTGCCGAGCACGTTTGTCTCGCCGACGGGGACAGCGACCATCTCATGGTACTACCCG
CACTGGTTCTACTCGTACCCGATCGAGCTTCCGCGCGTGACGTTCCAGGACCCCGTCATAGGGCGCGGCCTGTTC
TACACTTCGGGCGTGGAGAGCTTCATCTCGACCATGGAGACGAGCGCGCTCATGGGCATGAACGTCGCTCGGCTC
GTCGCCGACGAGTGTCCGGGTTGGTCGAGGGCGAGGACGGCGGCTGCGGATGGGGGGAGGCGAGCAATGAGGGAG
GATTTCTTCGTTCGGGTTGAGAGTGAGGTTGGTGGGATGATGATGCAGGATGAGTTGTGA
Gene >Ophio5|6047
ATGCGATTGCGGCTGGGCTTTGTCTTGGGTCTGGCAGCGGCGGTGGCTGGGCGGGGTGCGGATGTGAAGAATGTC
GCTATCGTTGGTGAGTCGATCCCTGAAGGGTCCGAGTCAGTTTGAGCCGGTCTCTGAAGTAGGCTGAGGCAGACG
CCGAAAGCTCGTCCTCTCGTCCCGAACCCGCTAGCCAGGCAAAATTACATGCTTGATACTGACACCGAATTCCCA
GGCGCCGGAGCCGCTGGCTCATCAGCAGCCTACTACCTAGCCAAATACGCCCGGCAAGAAGGCCTCGCCATCAAC
ACAACCGTGTTCGAGAAAACGGACCGCATCGGCGGACGAACCCTCACCGTCGACGCCTTCGATGATCCGGCCCAG
CGCGTCGAGCTGGGTGCTTCCATCTTCGTCGGCGTCAACCACATCATGTACAATGCCACCCGCACCTTTGGTCTC
TCGCTCGCAGACGTCGATGGCTCCGAGGACGGCGACGTGACACTCATCTGGGACGGCGAGAGCGTGCTCTTCCGT
TCCGTCGAGGGAACCTCGTGGTGGTGGGACGCGGCCAGGCTGTGGTGGCGTTATGGCACTGCGCCGTATAGGGCG
CTGAAGCTCGTTCGCCGCGTCATTTCCGTCTTCTTGAAGCTCTATGATGAGCCTTATTTCCCGTTCCGGTCTTTG
ACGAGGAGGGCGTATGAGCTGGGGTTGAATGAGGTTACGGCTCTGACGGGCGAGCAGTTTCTTGCCAAGAACAAG
GTGAGAAGGGCTACAGCTCCGCGTTGAATTATGGCATCTCACACCTCCCTACAGATCGACGCCGACTTCGCTCGC
CATCTTATGCAGCCCGCCACGCGTGTCAACTACGCTTCCAACCTGGCCTACATCCACGGCCTCGAGGCCATGGTC
TCCTTCGCCACCGAAGGAGCCATGTCCGTGCAGGGCGGAAACTGGCAGATCTTCGACCACATGGCCCGTAGCAGC
GGAGCCGCCATCCGCCGCAACACGTCCGTCACGGCCATCTCGCTCGAGAAAGGCATGATGAAGCCCGGGGCGCCG
AGGAAGTATCTCCTTTCAACGCGGGAGACGGGCGCGTCGTCGGCGACCTCGTACCCGGTCAGCTTCGACAACGTC
ATCGTCGCGACGCCGTGGCAATTCAGCGACATGGAGGCCGAAGAGGGCGTGCTCAAGCAGGACATTGACGAGATT
CCGTACATGAAGCTTCATGTCACGCTCTTTACCTCGCCTTTTGCCCTGAGGGCCGAATACTTTAACCTCGAAGGC
GGGATCAAGCCGCCCAGCAACGTGTATACGACACTCGGCAAGCACGAGCAGCCGAGGCCAGGGCCCGAGGGCGTG
GGCCGAACGGGCTTCTACTCCATCAGCACGCTGCGGAGGGTGACGAACCCCAAGACGCTGGAGAGGGAGTACCTC
TACAAGATCTTCTCCGTCTCGGCGGTGACGCCGCAGTTCTTGGCCGACATCTTGGGCGCCGAAGTGCCGAGCACG
TTTGTCTCGCCGACGGGGACAGCGACCATCTCATGGTACTACCCGCACTGGTTCTACTCGTACCCGATCGAGCTT
CCGCGCGTGACGTTCCAGGACCCCGTCATAGGGCGCGGCCTGTTCTACACTTCGGGCGTGGAGAGCTTCATCTCG
ACCATGGAGACGAGCGCGCTCATGGGCATGAACGTCGCTCGGCTCGTCGCCGACGAGTGTCCGGGTTGGTCGAGG
GCGAGGACGGCGGCTGCGGATGGGGGGAGGCGAGCAATGAGGGAGGATTTCTTCGTTCGGGTTGAGAGTGAGGTT
GGTGGGATGATGATGCAGGATGAGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail