Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|604
Gene name
Locationscaffold_116:17021..20152
Strand-
Gene length (bp)3131
Transcript length (bp)2889
Coding sequence length (bp)2886
Protein length (aa) 962

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20241 DUF6598 Domain of unknown function (DUF6598) 1.3E-20 722 959
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.0E-07 48 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 315 487 9.0E-10
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 315 487 9.0E-10
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 315 484 4.0E-09
sp|P9WI15|PPE24_MYCTU Uncharacterized PPE family protein PPE24 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe24 PE=3 SV=1 356 487 4.0E-09
sp|P9WI14|PPE24_MYCTO Uncharacterized PPE family protein PPE24 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppe24 PE=3 SV=1 356 487 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 315 487 9.0E-10
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 315 487 9.0E-10
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 315 484 4.0E-09
sp|P9WI15|PPE24_MYCTU Uncharacterized PPE family protein PPE24 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe24 PE=3 SV=1 356 487 4.0E-09
sp|P9WI14|PPE24_MYCTO Uncharacterized PPE family protein PPE24 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppe24 PE=3 SV=1 356 487 5.0E-09
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 356 652 1.0E-08
sp|P9WI15|PPE24_MYCTU Uncharacterized PPE family protein PPE24 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe24 PE=3 SV=1 356 483 4.0E-07
sp|P9WI14|PPE24_MYCTO Uncharacterized PPE family protein PPE24 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppe24 PE=3 SV=1 356 483 5.0E-07
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 356 434 1.0E-06
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 357 489 4.0E-06
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 357 489 4.0E-06
sp|Q6MWY2|PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppe54 PE=3 SV=1 357 489 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|604
MRRATTLILAGHLWLRWFGLGHASSLPGATDAHQSLVSRQDKIPVSFVYRGDGRSPQEIRAAGGFRPWGQDWQQE
SSFRVDRHSNSGPSGCGHQDFDDPRFVWRTAYVSLAKDVSTATKYGSWLYQIRATPNVLDSGNWDSEVMALGGIH
WRQIKGYAQIRESKGRDTVNEAAWINNPEYDVALYELSEWAALCDVNSSYPKALENGVDGAGMSGGAKEEAYRFM
TETKGMTNLFGTFPPQFDQYDLRLDIPGPLLSPLSPEAAQLQEDGQRLQIFVDMGAEGLNGLPERCHQTLREVFS
AGIDQESCTAAINNPSAAACGVVTAQNAGSRRRPCCKLAASLEKAMRTSQRPEAPSGRRKRDLYNDGSYNTDAGL
YNSGPYNTDPYSAGSYNTDPYHPDPYHTGPYNTGSYNTGPYNTDPYNTDPYSTSPYSTGRYNAHRYSHDRYNTNQ
RYNTDSHNTDRYNADRYNAGSYNTDRYNTDSYHNTRFNTFQQTIPQQCSASNNDVVDAYSGFNTDLLHHIFPHLT
SEMIQRLADGSCTRRQSGYTQNRDANLDSLCCALMNKLQKANSEPWHHEPRTDSWPRQDEPRYDLRPDYYEPETG
FRPSYYQPEADSRPWYNRPEADYGPSYYQPETSFGPGYYKPETNTRPSYYQPEIDSSPWYHEPKTDLRPTHNQPE
SNFRPSYFQPESNSRPWENRAPSGYPRQDTHTTSQAGKGQGRLMAHVTALTMTNIDNGREGKVYGTITATDRKGT
QAIYNVGRSSPELILTGEDISLNPERPIDPSQGFSIKVDLWKQGADMLQDGQLSYGTFSWDRDNRPAEYDVPLNA
VIKGPRGEASLSLVVLSQALVARVKVVMLQTDDEDPVDVFGNIMIQTQFFRKYLFSRSEIDSQSVRVGGEIPLIL
NHFPMPQFTPLRISLDLWDWDSSSPNEQIAKGEHSFLPDTTRRSTKTFTGYYGKVEVGVTWE
Coding >Ophio5|604
ATGCGCCGTGCTACGACCTTGATTCTGGCTGGCCACCTATGGCTCCGATGGTTCGGACTTGGGCATGCCAGCTCC
TTGCCGGGGGCCACTGATGCCCATCAGTCTCTCGTGAGTCGACAAGATAAGATACCCGTCAGCTTTGTCTACCGT
GGAGATGGAAGATCCCCTCAGGAAATCAGGGCAGCTGGCGGATTCCGACCCTGGGGCCAAGATTGGCAACAGGAA
TCGTCGTTTCGTGTAGATCGCCACTCCAATTCAGGTCCGAGTGGTTGCGGACATCAAGATTTCGATGACCCGAGA
TTTGTCTGGCGGACGGCATATGTCTCGCTAGCCAAAGACGTATCTACAGCCACTAAGTACGGATCTTGGCTTTAT
CAAATCCGTGCCACTCCGAATGTCCTCGACAGCGGAAACTGGGACTCCGAGGTTATGGCACTTGGAGGAATCCAC
TGGCGACAGATTAAGGGATATGCACAAATCAGAGAGTCGAAGGGAAGAGATACAGTCAATGAAGCAGCTTGGATC
AACAATCCGGAATACGATGTTGCCCTCTACGAACTGTCGGAATGGGCAGCCTTGTGCGACGTGAACAGTTCCTAT
CCAAAAGCTCTCGAGAATGGTGTTGATGGCGCAGGCATGTCCGGCGGCGCAAAAGAAGAAGCCTATCGGTTCATG
ACTGAAACTAAGGGCATGACCAACCTGTTTGGCACCTTTCCACCCCAATTCGACCAATACGATCTCAGGCTGGAT
ATACCTGGACCATTGCTTTCACCGCTGAGCCCCGAGGCTGCGCAATTGCAGGAGGACGGGCAACGGCTGCAGATC
TTTGTCGATATGGGCGCCGAGGGACTGAATGGCCTTCCCGAAAGATGCCACCAGACTCTACGAGAAGTCTTCTCC
GCTGGCATTGACCAAGAATCCTGCACGGCTGCAATAAACAACCCGAGTGCTGCTGCCTGTGGTGTTGTCACAGCT
CAAAACGCGGGATCGAGGAGGAGGCCTTGTTGCAAGCTCGCTGCTTCACTTGAGAAAGCGATGCGGACAAGTCAA
AGGCCAGAGGCACCATCTGGTAGGCGGAAGCGGGACCTTTACAACGATGGTTCTTACAACACCGACGCTGGACTT
TATAACTCTGGGCCCTACAACACTGACCCTTACAGCGCTGGTTCTTACAACACTGATCCTTACCACCCTGATCCG
TACCACACTGGTCCTTACAACACTGGTTCTTACAACACTGGTCCTTACAACACTGATCCTTACAACACTGATCCT
TACAGCACATCTCCTTATAGCACTGGACGCTATAATGCTCATCGTTATAGCCATGATCGCTACAACACTAATCAA
CGTTATAACACTGATTCACACAACACTGATCGCTACAACGCTGATCGCTACAATGCTGGTAGCTACAACACTGAT
CGTTACAACACTGATTCTTACCACAATACTCGTTTCAACACTTTTCAACAGACAATACCCCAGCAATGCTCTGCT
TCCAACAATGACGTTGTCGACGCTTATAGTGGCTTCAACACCGATCTCCTGCATCATATCTTTCCTCATCTCACA
TCGGAAATGATTCAGAGGCTGGCTGACGGCTCATGTACGCGACGCCAGTCGGGATACACGCAAAATAGAGATGCA
AATCTTGACAGCTTGTGCTGCGCACTGATGAACAAACTCCAAAAAGCTAACTCTGAACCTTGGCACCACGAGCCC
AGGACCGACTCTTGGCCCCGGCAAGATGAGCCTCGATACGACTTGAGGCCTGATTACTATGAGCCAGAAACCGGC
TTCAGGCCCTCGTACTATCAGCCCGAAGCCGACTCAAGGCCCTGGTATAATAGGCCCGAAGCCGACTATGGGCCG
AGTTACTATCAGCCCGAAACCAGCTTTGGGCCTGGTTATTACAAGCCCGAGACCAACACCAGGCCGTCTTACTAT
CAGCCCGAAATCGACTCGAGCCCTTGGTATCATGAGCCCAAAACCGACTTGAGGCCCACACATAACCAGCCCGAA
AGCAACTTCAGGCCTTCGTACTTCCAGCCCGAAAGCAACTCGAGGCCTTGGGAGAACAGGGCTCCGAGCGGTTAT
CCTCGGCAGGATACGCATACCACGTCCCAAGCTGGAAAGGGCCAAGGTCGCTTGATGGCTCACGTCACGGCGTTG
ACGATGACAAACATTGACAATGGAAGGGAAGGGAAGGTCTATGGCACCATCACTGCCACAGACCGAAAAGGGACA
CAAGCCATCTACAACGTCGGCAGGTCTTCACCGGAACTGATTCTCACAGGAGAAGATATCTCGCTGAACCCCGAA
AGACCCATCGATCCTTCACAGGGCTTCTCCATCAAGGTAGATCTGTGGAAGCAGGGTGCAGACATGCTTCAAGAC
GGCCAACTCAGCTACGGAACGTTTTCTTGGGATCGCGACAATCGACCGGCTGAGTACGACGTACCGTTGAATGCA
GTCATCAAGGGCCCGCGCGGCGAGGCGTCTCTGAGCTTGGTCGTCCTTAGCCAGGCCCTAGTAGCCAGGGTCAAA
GTCGTTATGCTTCAAACCGATGACGAGGATCCCGTCGACGTCTTCGGCAACATCATGATTCAGACGCAATTCTTC
CGAAAGTACCTCTTCAGCCGCTCCGAAATAGATTCCCAATCTGTGAGAGTTGGCGGCGAGATCCCCTTGATACTA
AACCACTTTCCTATGCCGCAGTTTACTCCGCTTCGAATTTCGCTCGACCTCTGGGACTGGGACAGTTCATCGCCC
AACGAGCAGATCGCCAAAGGTGAACATTCGTTTTTGCCCGACACCACCCGCAGGAGCACGAAAACCTTTACCGGC
TATTACGGAAAAGTTGAAGTTGGCGTCACCTGGGAA
Transcript >Ophio5|604
ATGCGCCGTGCTACGACCTTGATTCTGGCTGGCCACCTATGGCTCCGATGGTTCGGACTTGGGCATGCCAGCTCC
TTGCCGGGGGCCACTGATGCCCATCAGTCTCTCGTGAGTCGACAAGATAAGATACCCGTCAGCTTTGTCTACCGT
GGAGATGGAAGATCCCCTCAGGAAATCAGGGCAGCTGGCGGATTCCGACCCTGGGGCCAAGATTGGCAACAGGAA
TCGTCGTTTCGTGTAGATCGCCACTCCAATTCAGGTCCGAGTGGTTGCGGACATCAAGATTTCGATGACCCGAGA
TTTGTCTGGCGGACGGCATATGTCTCGCTAGCCAAAGACGTATCTACAGCCACTAAGTACGGATCTTGGCTTTAT
CAAATCCGTGCCACTCCGAATGTCCTCGACAGCGGAAACTGGGACTCCGAGGTTATGGCACTTGGAGGAATCCAC
TGGCGACAGATTAAGGGATATGCACAAATCAGAGAGTCGAAGGGAAGAGATACAGTCAATGAAGCAGCTTGGATC
AACAATCCGGAATACGATGTTGCCCTCTACGAACTGTCGGAATGGGCAGCCTTGTGCGACGTGAACAGTTCCTAT
CCAAAAGCTCTCGAGAATGGTGTTGATGGCGCAGGCATGTCCGGCGGCGCAAAAGAAGAAGCCTATCGGTTCATG
ACTGAAACTAAGGGCATGACCAACCTGTTTGGCACCTTTCCACCCCAATTCGACCAATACGATCTCAGGCTGGAT
ATACCTGGACCATTGCTTTCACCGCTGAGCCCCGAGGCTGCGCAATTGCAGGAGGACGGGCAACGGCTGCAGATC
TTTGTCGATATGGGCGCCGAGGGACTGAATGGCCTTCCCGAAAGATGCCACCAGACTCTACGAGAAGTCTTCTCC
GCTGGCATTGACCAAGAATCCTGCACGGCTGCAATAAACAACCCGAGTGCTGCTGCCTGTGGTGTTGTCACAGCT
CAAAACGCGGGATCGAGGAGGAGGCCTTGTTGCAAGCTCGCTGCTTCACTTGAGAAAGCGATGCGGACAAGTCAA
AGGCCAGAGGCACCATCTGGTAGGCGGAAGCGGGACCTTTACAACGATGGTTCTTACAACACCGACGCTGGACTT
TATAACTCTGGGCCCTACAACACTGACCCTTACAGCGCTGGTTCTTACAACACTGATCCTTACCACCCTGATCCG
TACCACACTGGTCCTTACAACACTGGTTCTTACAACACTGGTCCTTACAACACTGATCCTTACAACACTGATCCT
TACAGCACATCTCCTTATAGCACTGGACGCTATAATGCTCATCGTTATAGCCATGATCGCTACAACACTAATCAA
CGTTATAACACTGATTCACACAACACTGATCGCTACAACGCTGATCGCTACAATGCTGGTAGCTACAACACTGAT
CGTTACAACACTGATTCTTACCACAATACTCGTTTCAACACTTTTCAACAGACAATACCCCAGCAATGCTCTGCT
TCCAACAATGACGTTGTCGACGCTTATAGTGGCTTCAACACCGATCTCCTGCATCATATCTTTCCTCATCTCACA
TCGGAAATGATTCAGAGGCTGGCTGACGGCTCATGTACGCGACGCCAGTCGGGATACACGCAAAATAGAGATGCA
AATCTTGACAGCTTGTGCTGCGCACTGATGAACAAACTCCAAAAAGCTAACTCTGAACCTTGGCACCACGAGCCC
AGGACCGACTCTTGGCCCCGGCAAGATGAGCCTCGATACGACTTGAGGCCTGATTACTATGAGCCAGAAACCGGC
TTCAGGCCCTCGTACTATCAGCCCGAAGCCGACTCAAGGCCCTGGTATAATAGGCCCGAAGCCGACTATGGGCCG
AGTTACTATCAGCCCGAAACCAGCTTTGGGCCTGGTTATTACAAGCCCGAGACCAACACCAGGCCGTCTTACTAT
CAGCCCGAAATCGACTCGAGCCCTTGGTATCATGAGCCCAAAACCGACTTGAGGCCCACACATAACCAGCCCGAA
AGCAACTTCAGGCCTTCGTACTTCCAGCCCGAAAGCAACTCGAGGCCTTGGGAGAACAGGGCTCCGAGCGGTTAT
CCTCGGCAGGATACGCATACCACGTCCCAAGCTGGAAAGGGCCAAGGTCGCTTGATGGCTCACGTCACGGCGTTG
ACGATGACAAACATTGACAATGGAAGGGAAGGGAAGGTCTATGGCACCATCACTGCCACAGACCGAAAAGGGACA
CAAGCCATCTACAACGTCGGCAGGTCTTCACCGGAACTGATTCTCACAGGAGAAGATATCTCGCTGAACCCCGAA
AGACCCATCGATCCTTCACAGGGCTTCTCCATCAAGGTAGATCTGTGGAAGCAGGGTGCAGACATGCTTCAAGAC
GGCCAACTCAGCTACGGAACGTTTTCTTGGGATCGCGACAATCGACCGGCTGAGTACGACGTACCGTTGAATGCA
GTCATCAAGGGCCCGCGCGGCGAGGCGTCTCTGAGCTTGGTCGTCCTTAGCCAGGCCCTAGTAGCCAGGGTCAAA
GTCGTTATGCTTCAAACCGATGACGAGGATCCCGTCGACGTCTTCGGCAACATCATGATTCAGACGCAATTCTTC
CGAAAGTACCTCTTCAGCCGCTCCGAAATAGATTCCCAATCTGTGAGAGTTGGCGGCGAGATCCCCTTGATACTA
AACCACTTTCCTATGCCGCAGTTTACTCCGCTTCGAATTTCGCTCGACCTCTGGGACTGGGACAGTTCATCGCCC
AACGAGCAGATCGCCAAAGGTGAACATTCGTTTTTGCCCGACACCACCCGCAGGAGCACGAAAACCTTTACCGGC
TATTACGGAAAAGTTGAAGTTGGCGTCACCTGGGAATAG
Gene >Ophio5|604
ATGCGCCGTGCTACGACCTTGATTCTGGCTGGCCACCTATGGCTCCGATGGTTCGGACTTGGGCATGCCAGCTCC
TTGCCGGGGGCCACTGATGCCCATCAGTCTCTCGTGAGTCGACAAGATAAGATACCCGTCAGCTTTGTCTACCGT
GGAGATGGAAGATCCCCTCAGGAAATCAGGGCAGCTGGCGGATTCCGACCCTGGGGCCAAGATTGGCAACAGGAA
TCGTCGTTTCGTGTAGATCGCCACTCCAATTCAGGTCCGAGTGGTTGCGGACATCAAGATTTCGATGACCCGAGA
TTTGTCTGGCGGACGGCATATGTCTCGCTAGCCAAAGACGTATCTACAGCCACTAAGTACGGATCTTGGCTTTAT
CAAATCCGTGCCACTCCGAATGTCCTCGACAGCGGAAACTGGGACTCCGAGGTTATGGCACTTGGAGGAATCCAC
TGGCGACAGATTAAGGGATATGCACAAATCAGAGAGTCGAAGGGAAGAGATACAGTCAATGAAGCAGCTTGGATC
AACAATCCGGAATACGATGTTGCCCTCTACGAACTGTCGGAATGGGCAGCCTTGTGCGACGTGAACAGTTCCTAT
CCAAAAGCTCTCGAGAATGGTGTTGATGGCGCAGGCATGTCCGGCGGCGCAAAAGAAGAAGCCTATCGGTTCATG
ACTGAAACTAAGGGCATGACCAACCTGTTTGGCACCTTTCCACCCCAATTCGACCAATACGATCTCAGGCTGGAT
ATACCTGGACCATTGCTTTCACCGCTGAGCCCCGAGGCTGCGCAATTGCAGGGTATAAGCCCAATGCCTTTAAGG
GACAGAACGAGGTACTGACACTGAAATAGAGGACGGGCAACGGCTGCAGATCTTTGTCGATATGGGCGCCGAGGG
ACTGAATGGCCTTCCCGAAAGATGCCACCAGACTCTACGAGAAGTCTTCTCCGCTGGCATTGACCAAGAATCCTG
CACGGCTGCAATAAACAACCCGAGTGCTGCTGCCTGTGGTGTTGTCACAGCTCAAAACGCGGGTATGTGCATCAG
CACGGGGCTTCGAAGCTGTTCAAAGAAGTTACCTAGACTGATAACTCGCTGTAGGATCGAGGAGGAGGCCTTGTT
GCAAGCTCGCTGCTTCACTTGAGAAAGCGATGCGGACAAGTCAAAGGCCAGAGGCACCATCTGGTAGGCGGAAGC
GGGACCTTTACAACGATGGTTCTTACAACACCGACGCTGGACTTTATAACTCTGGGCCCTACAACACTGACCCTT
ACAGCGCTGGTTCTTACAACACTGATCCTTACCACCCTGATCCGTACCACACTGGTCCTTACAACACTGGTTCTT
ACAACACTGGTCCTTACAACACTGATCCTTACAACACTGATCCTTACAGCACATCTCCTTATAGCACTGGACGCT
ATAATGCTCATCGTTATAGCCATGATCGCTACAACACTAATCAACGTTATAACACTGATTCACACAACACTGATC
GCTACAACGCTGATCGCTACAATGCTGGTAGCTACAACACTGATCGTTACAACACTGATTCTTACCACAATACTC
GTTTCAACACTTTTCAACAGACAATACCCCAGCAATGCTCTGCTTCCAACAATGACGGTAGGTGAGCTGACCGGC
TGAAAGGCGACATTCGGGCTAACGGCCATGCCTGCAGTTGTCGACGCTTATAGTGGCTTCAACACCGATCTCCTG
CATCATATCTTTCCTCATCTCACATCGGAAATGATTCAGAGGCTGGCTGACGGCTCATGTACGCGACGCCAGTCG
GGATACACGCAAAATAGTAAGGAATCGTAACACCTAAAAACCGCCAACGCAAGCAGGCTCGCTCACTGACGAACA
ACGTGGAAGGAGATGCAAATCTTGACAGCTTGTGCTGCGCACTGATGAACAAACTCCAAAAAGCTAACTCTGAAC
CTTGGCACCACGAGCCCAGGACCGACTCTTGGCCCCGGCAAGATGAGCCTCGATACGACTTGAGGCCTGATTACT
ATGAGCCAGAAACCGGCTTCAGGCCCTCGTACTATCAGCCCGAAGCCGACTCAAGGCCCTGGTATAATAGGCCCG
AAGCCGACTATGGGCCGAGTTACTATCAGCCCGAAACCAGCTTTGGGCCTGGTTATTACAAGCCCGAGACCAACA
CCAGGCCGTCTTACTATCAGCCCGAAATCGACTCGAGCCCTTGGTATCATGAGCCCAAAACCGACTTGAGGCCCA
CACATAACCAGCCCGAAAGCAACTTCAGGCCTTCGTACTTCCAGCCCGAAAGCAACTCGAGGCCTTGGGAGAACA
GGGCTCCGAGCGGTTATCCTCGGCAGGATACGCATACCACGTCCCAAGCTGGAAAGGGCCAAGGTCGCTTGATGG
CTCACGTCACGGCGTTGACGATGACAAACATTGACAATGGAAGGGAAGGGAAGGTCTATGGCACCATCACTGCCA
CAGACCGAAAAGGGACACAAGCCATCTACAACGTCGGCAGGTCTTCACCGGAACTGATTCTCACAGGAGAAGATA
TCTCGCTGAACCCCGAAAGACCCATCGATCCTTCACAGGGCTTCTCCATCAAGGTAGATCTGTGGAAGCAGGGTG
CAGACATGCTTCAAGACGGCCAACTCAGCTACGGAACGTTTTCTTGGGATCGCGACAATCGACCGGCTGAGTACG
ACGTACCGTTGAATGCAGTCATCAAGGGCCCGCGCGGCGAGGCGTCTCTGAGCTTGGTCGTCCTTAGCCAGGCCC
TAGTAGCCAGGGTCAAAGTCGTTATGCTTCAAACCGATGACGAGGATCCCGTCGACGTCTTCGGCAACATCATGA
TTCAGACGCAATTCTTCCGAAAGTACCTCTTCAGCCGCTCCGAAATAGATTCCCAATCTGTGAGAGTTGGCGGCG
AGATCCCCTTGATACTAAACCACTTTCCTATGCCGCAGTTTACTCCGCTTCGAATTTCGCTCGACCTCTGGGACT
GGGACAGTTCATCGCCCAACGAGCAGATCGCCAAAGGTGAACATTCGTTTTTGCCCGACACCACCCGCAGGAGCA
CGAAAACCTTTACCGGCTATTACGGAAAAGTTGAAGTTGGCGTCACCTGGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail