Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6035
Gene name
Locationscaffold_51:15473..16031
Strand-
Gene length (bp)558
Transcript length (bp)414
Coding sequence length (bp)411
Protein length (aa) 137

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 12.08 1.94 22.22
CcL In ants, during behavior modification 2.74 0.00 5.68
CcD In ants, recently dead 1.81 0.00 4.40

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.023042 yes
SC16a CcD 0.013548 yes
CcL CcD 0.590225 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6035
MKFFHVFSAFALVAAVASSPDVDERAIIPGLSGHHDALYHDGHKKGDKKSVKKKGRKKAIRKGPKGCSAAASPRC
CVPQHCQCNDGHVYRFNDANSKAGGSGCDPPMEFLAESTALLPEYCCFPPHLCVGPNGQMNC
Coding >Ophio5|6035
ATGAAGTTTTTCCACGTCTTTTCGGCTTTTGCTCTCGTGGCTGCGGTTGCGTCTTCGCCCGATGTTGACGAGCGT
GCTATTATCCCAGGCCTGAGTGGTCACCACGACGCCTTGTATCACGACGGCCATAAGAAAGGCGACAAGAAAAGT
GTCAAGAAAAAAGGCCGGAAGAAGGCCATCAGAAAGGGTCCCAAGGGCTGCTCAGCAGCGGCCTCTCCGCGTTGC
TGCGTCCCGCAACATTGTCAATGCAATGATGGCCATGTATATCGGTTCAACGATGCAAACTCCAAGGCCGGCGGA
AGCGGCTGCGATCCGCCCATGGAGTTTCTCGCTGAATCTACTGCCCTGTTGCCGGAATATTGTTGTTTTCCGCCT
CATCTTTGTGTAGGCCCCAACGGCCAGATGAATTGT
Transcript >Ophio5|6035
ATGAAGTTTTTCCACGTCTTTTCGGCTTTTGCTCTCGTGGCTGCGGTTGCGTCTTCGCCCGATGTTGACGAGCGT
GCTATTATCCCAGGCCTGAGTGGTCACCACGACGCCTTGTATCACGACGGCCATAAGAAAGGCGACAAGAAAAGT
GTCAAGAAAAAAGGCCGGAAGAAGGCCATCAGAAAGGGTCCCAAGGGCTGCTCAGCAGCGGCCTCTCCGCGTTGC
TGCGTCCCGCAACATTGTCAATGCAATGATGGCCATGTATATCGGTTCAACGATGCAAACTCCAAGGCCGGCGGA
AGCGGCTGCGATCCGCCCATGGAGTTTCTCGCTGAATCTACTGCCCTGTTGCCGGAATATTGTTGTTTTCCGCCT
CATCTTTGTGTAGGCCCCAACGGCCAGATGAATTGTTAG
Gene >Ophio5|6035
ATGAAGTTTTTCCACGTCTTTTCGGCTTTTGCTCTCGTGGCTGCGGTTGCGTCTTCGCCCGATGTTGACGAGCGT
GCTATTATCCCAGGCCTGAGTGGTCACCACGACGCCTTGTATCACGACGGCCATAAGAAAGGCGACAAGAAAAGT
GTCAAGAAAAAAGGCCGGAAGAAGGCCATCAGAAAGGGTCCCAAGGGCTGCTCAGCAGCGTGAGTCAATCTCATC
ACTTCAAGGCTTTCTTTCTCATTTGTTCACTTGAGTCACCAGGGCCTCTCCGCGTTGCTGCGTCCCGCAACATTG
TCAATGCAATGATGGTGAGCGGTTGCTGCTGTCAGACATTTCGAGAGCTCAATACGAGGAAGCTAACGAAACCCC
TCCCCCCTCCCCCCCCTTGCCACAGGCCATGTATATCGGTTCAACGATGCAAACTCCAAGGCCGGCGGAAGCGGC
TGCGATCCGCCCATGGAGTTTCTCGCTGAATCTACTGCCCTGTTGCCGGAATATTGTTGTTTTCCGCCTCATCTT
TGTGTAGGCCCCAACGGCCAGATGAATTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail