Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6023
Gene name
Locationscaffold_509:13828..14810
Strand-
Gene length (bp)982
Transcript length (bp)879
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04750 Far-17a_AIG1 FAR-17a/AIG1-like protein 6.5E-06 83 246

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 86 108 22
3 129 151 22
4 189 211 22
5 232 254 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6023
MGRRCCSFGAGPWDPERRFETSSLIGPWSLFLCRAGMSVYGFVTIFFIIVYSCTAPDTPPPKSPPPQAPNHDTAT
GCASVPRSFSYFTVLSYWGLAFYFLVAALHSFSYIRSARPFLHRLPRPLQALHSLFYSSVVTFPFLVSLTYWAVL
YRAWFPSAFDAWRNFSQHALNSVFALFEILVPRVRPLPWIHLPWLALILLAYLAIAFITLADQGFYTYAFLDYSR
TGGRAHVAAYTLGITAALVLIFCAVHFLIRLRCWLTESKLGLDAKNAREPVLVADVEVADVEIKGSS
Coding >Ophio5|6023
ATGGGCCGCCGTTGCTGCTCCTTCGGCGCCGGGCCGTGGGACCCCGAGCGCCGGTTCGAAACCTCGTCTCTGATC
GGGCCCTGGTCGTTGTTCCTCTGTCGGGCCGGCATGTCCGTCTATGGCTTCGTCACCATCTTCTTCATCATCGTC
TATTCTTGTACCGCCCCGGACACACCACCTCCTAAATCTCCTCCTCCCCAGGCACCAAATCACGATACCGCTACA
GGTTGCGCCTCTGTTCCTCGATCATTCTCCTACTTTACCGTCCTCTCCTACTGGGGCCTCGCCTTCTATTTCCTC
GTCGCCGCCTTGCACTCCTTTTCCTACATCCGCTCCGCCAGGCCCTTTCTCCATCGCCTGCCACGCCCGCTTCAG
GCCCTTCATTCTCTCTTCTACTCCTCCGTCGTCACTTTTCCTTTTCTCGTCTCTCTCACCTATTGGGCCGTGCTC
TACCGCGCTTGGTTCCCTTCCGCTTTTGACGCCTGGCGCAACTTCAGCCAGCACGCTCTAAATTCCGTCTTCGCC
CTCTTCGAGATACTCGTTCCTCGCGTCCGGCCGCTGCCCTGGATTCATCTGCCGTGGCTCGCTCTCATCCTCCTC
GCTTATCTAGCCATCGCCTTCATCACCTTGGCAGATCAGGGCTTCTACACCTACGCCTTTCTTGACTACAGCCGC
ACCGGTGGTCGCGCTCATGTCGCTGCTTACACCCTCGGCATCACCGCCGCTCTCGTCCTCATCTTCTGCGCCGTT
CACTTCCTTATCCGCTTACGCTGCTGGCTGACCGAGTCCAAGCTCGGCCTCGACGCCAAGAACGCCCGCGAGCCG
GTATTGGTTGCCGATGTCGAGGTCGCCGACGTCGAGATCAAGGGGTCAAGT
Transcript >Ophio5|6023
ATGGGCCGCCGTTGCTGCTCCTTCGGCGCCGGGCCGTGGGACCCCGAGCGCCGGTTCGAAACCTCGTCTCTGATC
GGGCCCTGGTCGTTGTTCCTCTGTCGGGCCGGCATGTCCGTCTATGGCTTCGTCACCATCTTCTTCATCATCGTC
TATTCTTGTACCGCCCCGGACACACCACCTCCTAAATCTCCTCCTCCCCAGGCACCAAATCACGATACCGCTACA
GGTTGCGCCTCTGTTCCTCGATCATTCTCCTACTTTACCGTCCTCTCCTACTGGGGCCTCGCCTTCTATTTCCTC
GTCGCCGCCTTGCACTCCTTTTCCTACATCCGCTCCGCCAGGCCCTTTCTCCATCGCCTGCCACGCCCGCTTCAG
GCCCTTCATTCTCTCTTCTACTCCTCCGTCGTCACTTTTCCTTTTCTCGTCTCTCTCACCTATTGGGCCGTGCTC
TACCGCGCTTGGTTCCCTTCCGCTTTTGACGCCTGGCGCAACTTCAGCCAGCACGCTCTAAATTCCGTCTTCGCC
CTCTTCGAGATACTCGTTCCTCGCGTCCGGCCGCTGCCCTGGATTCATCTGCCGTGGCTCGCTCTCATCCTCCTC
GCTTATCTAGCCATCGCCTTCATCACCTTGGCAGATCAGGGCTTCTACACCTACGCCTTTCTTGACTACAGCCGC
ACCGGTGGTCGCGCTCATGTCGCTGCTTACACCCTCGGCATCACCGCCGCTCTCGTCCTCATCTTCTGCGCCGTT
CACTTCCTTATCCGCTTACGCTGCTGGCTGACCGAGTCCAAGCTCGGCCTCGACGCCAAGAACGCCCGCGAGCCG
GTATTGGTTGCCGATGTCGAGGTCGCCGACGTCGAGATCAAGGGGTCAAGTTAG
Gene >Ophio5|6023
ATGGGCCGCCGTTGCTGCTCCTTCGGCGCCGGGCCGTGGGACCCCGAGCGCCGGTTCGAAACCTCGTCTCTGATC
GGGCCCTGGTCGTTGTTCCTCTGTCGGGCCGGCATGGTGCGTTTGTCGGTCCCCGACCCTTCTTCTGACGTCTTC
TTAGCGTTACTTGGCTTACCGTGTCAGCAAAAATGAAAAAAATAAAAAAATAAAAAAATAAAAGTCCGTCTATGG
CTTCGTCACCATCTTCTTCATCATCGTCTATTCTTGTACCGCCCCGGACACACCACCTCCTAAATCTCCTCCTCC
CCAGGCACCAAATCACGATACCGCTACAGGTTGCGCCTCTGTTCCTCGATCATTCTCCTACTTTACCGTCCTCTC
CTACTGGGGCCTCGCCTTCTATTTCCTCGTCGCCGCCTTGCACTCCTTTTCCTACATCCGCTCCGCCAGGCCCTT
TCTCCATCGCCTGCCACGCCCGCTTCAGGCCCTTCATTCTCTCTTCTACTCCTCCGTCGTCACTTTTCCTTTTCT
CGTCTCTCTCACCTATTGGGCCGTGCTCTACCGCGCTTGGTTCCCTTCCGCTTTTGACGCCTGGCGCAACTTCAG
CCAGCACGCTCTAAATTCCGTCTTCGCCCTCTTCGAGATACTCGTTCCTCGCGTCCGGCCGCTGCCCTGGATTCA
TCTGCCGTGGCTCGCTCTCATCCTCCTCGCTTATCTAGCCATCGCCTTCATCACCTTGGCAGATCAGGGCTTCTA
CACCTACGCCTTTCTTGACTACAGCCGCACCGGTGGTCGCGCTCATGTCGCTGCTTACACCCTCGGCATCACCGC
CGCTCTCGTCCTCATCTTCTGCGCCGTTCACTTCCTTATCCGCTTACGCTGCTGGCTGACCGAGTCCAAGCTCGG
CCTCGACGCCAAGAACGCCCGCGAGCCGGTATTGGTTGCCGATGTCGAGGTCGCCGACGTCGAGATCAAGGGGTC
AAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail