Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6012
Gene name
Locationscaffold_508:384..4981
Strand-
Gene length (bp)4597
Transcript length (bp)4413
Coding sequence length (bp)4410
Protein length (aa) 1470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13964 Kelch_6 Kelch motif 2.0E-12 285 326
PF13854 Kelch_5 Kelch motif 2.2E-08 282 320
PF13418 Kelch_4 Galactose oxidase, central domain 9.0E-05 227 272
PF13418 Kelch_4 Galactose oxidase, central domain 4.5E-07 285 326
PF13418 Kelch_4 Galactose oxidase, central domain 1.0E-04 335 385
PF01344 Kelch_1 Kelch motif 5.4E-05 228 273
PF01344 Kelch_1 Kelch motif 9.9E-11 285 326
PF13415 Kelch_3 Galactose oxidase, central domain 9.7E-08 295 342
PF13415 Kelch_3 Galactose oxidase, central domain 4.9E-05 346 394
PF07646 Kelch_2 Kelch motif 2.7E-07 285 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 101 495 7.0E-85
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 102 428 1.0E-66
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 92 427 3.0E-64
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 131 402 6.0E-36
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 170 440 6.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 101 495 7.0E-85
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 102 428 1.0E-66
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 92 427 3.0E-64
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 131 402 6.0E-36
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 170 440 6.0E-27
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 168 429 7.0E-23
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 164 463 9.0E-23
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 171 404 2.0E-22
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 171 404 2.0E-22
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 171 404 2.0E-22
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 171 429 3.0E-22
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 163 415 2.0E-21
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 171 415 3.0E-21
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 171 415 3.0E-21
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 171 363 1.0E-20
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 168 405 2.0E-20
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 115 395 2.0E-20
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 163 415 3.0E-20
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 196 435 3.0E-20
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 174 415 2.0E-19
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 168 429 2.0E-19
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 134 404 5.0E-19
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 171 410 6.0E-19
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 215 404 7.0E-19
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 215 404 7.0E-19
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 215 404 9.0E-19
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 215 389 1.0E-18
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 215 404 2.0E-18
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 162 413 2.0E-18
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 227 404 5.0E-18
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 108 440 6.0E-18
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 230 405 1.0E-17
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 170 405 1.0E-17
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 174 415 2.0E-17
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 193 435 4.0E-17
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 173 405 6.0E-17
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 174 404 7.0E-17
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 164 410 8.0E-17
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 168 405 8.0E-17
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 169 416 1.0E-16
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 169 416 1.0E-16
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 174 404 1.0E-16
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 169 384 1.0E-16
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 169 384 1.0E-16
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 162 410 2.0E-16
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 169 384 2.0E-16
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 174 404 2.0E-16
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 169 384 2.0E-16
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 169 416 4.0E-16
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 108 395 1.0E-15
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 228 404 1.0E-15
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 215 434 1.0E-15
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 228 404 1.0E-15
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 173 411 2.0E-15
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 283 429 2.0E-15
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 169 351 2.0E-15
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 108 395 2.0E-15
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 170 434 4.0E-15
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 170 434 1.0E-14
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 169 416 2.0E-14
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 87 304 2.0E-14
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 117 344 2.0E-14
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 102 317 3.0E-14
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 166 413 4.0E-14
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 116 395 4.0E-14
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 97 317 7.0E-14
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 97 317 8.0E-14
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 228 404 8.0E-14
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 97 317 9.0E-14
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 101 370 2.0E-13
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 171 354 2.0E-13
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 268 419 2.0E-13
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 268 416 2.0E-13
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 184 353 2.0E-13
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 184 353 2.0E-13
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 171 354 3.0E-13
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 171 354 3.0E-13
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 167 429 4.0E-13
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 167 429 4.0E-13
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 184 353 4.0E-13
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 268 419 5.0E-13
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 283 429 5.0E-13
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 134 378 7.0E-13
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 269 429 1.0E-12
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 269 429 1.0E-12
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 134 378 1.0E-12
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 134 378 1.0E-12
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 166 424 1.0E-12
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 167 363 1.0E-12
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 205 356 2.0E-12
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 185 410 2.0E-12
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 269 429 3.0E-12
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 269 429 3.0E-12
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 183 403 3.0E-12
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 185 410 3.0E-12
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 134 370 4.0E-12
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 225 419 4.0E-12
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 149 385 5.0E-12
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 184 353 8.0E-12
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 94 373 2.0E-11
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 169 385 2.0E-11
sp|Q25386|SCRB_LIMPO Beta-scruin OS=Limulus polyphemus PE=2 SV=1 185 429 2.0E-11
sp|Q5VV63|ATRN1_HUMAN Attractin-like protein 1 OS=Homo sapiens GN=ATRNL1 PE=2 SV=2 162 416 2.0E-11
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 183 403 3.0E-11
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 207 406 3.0E-11
sp|Q6A051|ATRN1_MOUSE Attractin-like protein 1 OS=Mus musculus GN=Atrnl1 PE=1 SV=2 162 416 3.0E-11
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 219 404 5.0E-11
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 215 404 6.0E-11
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 167 429 7.0E-11
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 169 424 9.0E-11
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 180 403 1.0E-10
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 226 432 1.0E-10
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 183 403 1.0E-10
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 226 432 1.0E-10
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 215 404 2.0E-10
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 116 392 2.0E-10
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 171 415 2.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 171 307 2.0E-10
sp|Q80TF4|KLH13_MOUSE Kelch-like protein 13 OS=Mus musculus GN=Klhl13 PE=2 SV=3 200 416 2.0E-10
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 226 432 3.0E-10
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 171 415 3.0E-10
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 171 404 3.0E-10
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 167 404 3.0E-10
sp|A6QQY2|KLH13_BOVIN Kelch-like protein 13 OS=Bos taurus GN=KLHL13 PE=2 SV=1 223 416 3.0E-10
sp|Q96M94|KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens GN=KLHL15 PE=1 SV=2 168 374 3.0E-10
sp|Q9P2N7|KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens GN=KLHL13 PE=1 SV=3 223 416 3.0E-10
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 162 411 4.0E-10
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 162 448 5.0E-10
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 215 429 5.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 229 374 5.0E-10
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 169 354 6.0E-10
sp|Q6DEL7|KLH15_DANRE Kelch-like protein 15 OS=Danio rerio GN=klhl15 PE=2 SV=1 168 374 6.0E-10
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 162 411 1.0E-09
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 225 416 2.0E-09
sp|Q5ZLD3|KLH13_CHICK Kelch-like protein 13 OS=Gallus gallus GN=KLHL13 PE=2 SV=1 223 416 2.0E-09
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 174 405 2.0E-09
sp|Q2T9Z7|KLHL9_BOVIN Kelch-like protein 9 OS=Bos taurus GN=KLHL9 PE=2 SV=1 223 416 2.0E-09
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 225 416 3.0E-09
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 171 357 4.0E-09
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 221 451 4.0E-09
sp|Q9P2J3|KLHL9_HUMAN Kelch-like protein 9 OS=Homo sapiens GN=KLHL9 PE=1 SV=2 223 416 4.0E-09
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 283 404 4.0E-09
sp|Q6ZPT1|KLHL9_MOUSE Kelch-like protein 9 OS=Mus musculus GN=Klhl9 PE=2 SV=2 223 416 6.0E-09
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 169 424 6.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 213 392 8.0E-09
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 214 405 9.0E-09
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 103 245 2.0E-08
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 169 424 2.0E-08
sp|D3ZZC3|KLH22_RAT Kelch-like protein 22 OS=Rattus norvegicus GN=Klhl22 PE=1 SV=1 232 426 2.0E-08
sp|Q99JN2|KLH22_MOUSE Kelch-like protein 22 OS=Mus musculus GN=Klhl22 PE=1 SV=1 232 404 2.0E-08
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 149 371 3.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 286 447 3.0E-08
sp|Q9H0H3|KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens GN=KLHL25 PE=1 SV=1 168 404 3.0E-08
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 298 419 4.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 321 419 4.0E-08
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 164 353 5.0E-08
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 213 404 5.0E-08
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 169 424 5.0E-08
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 225 416 6.0E-08
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 174 404 6.0E-08
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 169 444 6.0E-08
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 225 416 7.0E-08
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 171 410 8.0E-08
sp|O75882|ATRN_HUMAN Attractin OS=Homo sapiens GN=ATRN PE=1 SV=2 173 404 8.0E-08
sp|O75882|ATRN_HUMAN Attractin OS=Homo sapiens GN=ATRN PE=1 SV=2 163 413 8.0E-08
sp|Q4KLM4|KLH25_RAT Kelch-like protein 25 OS=Rattus norvegicus GN=Klhl25 PE=2 SV=1 168 404 9.0E-08
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 219 416 1.0E-07
sp|Q8R2P1|KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus GN=Klhl25 PE=2 SV=1 168 404 1.0E-07
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 174 426 1.0E-07
sp|Q9WU60|ATRN_MOUSE Attractin OS=Mus musculus GN=Atrn PE=1 SV=3 163 413 2.0E-07
sp|Q9WU60|ATRN_MOUSE Attractin OS=Mus musculus GN=Atrn PE=1 SV=3 173 404 2.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 176 325 3.0E-07
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 174 404 3.0E-07
sp|Q69ZK5|KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus GN=Klhl14 PE=1 SV=2 236 404 3.0E-07
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 333 435 4.0E-07
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 174 382 4.0E-07
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 164 353 5.0E-07
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 166 404 5.0E-07
sp|Q5R774|KEAP1_PONAB Kelch-like ECH-associated protein 1 OS=Pongo abelii GN=KEAP1 PE=2 SV=1 173 404 5.0E-07
sp|Q5F3N5|KLH14_CHICK Kelch-like protein 14 OS=Gallus gallus GN=KLHL14 PE=2 SV=1 236 404 5.0E-07
sp|D2HEW7|KLH22_AILME Kelch-like protein 22 OS=Ailuropoda melanoleuca GN=KLHL22 PE=3 SV=1 232 426 5.0E-07
sp|Q0D2A9|KLH25_XENTR Kelch-like protein 25 OS=Xenopus tropicalis GN=klhl25 PE=2 SV=1 168 404 5.0E-07
sp|Q53GT1|KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens GN=KLHL22 PE=1 SV=2 232 426 5.0E-07
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 225 416 6.0E-07
sp|Q14145|KEAP1_HUMAN Kelch-like ECH-associated protein 1 OS=Homo sapiens GN=KEAP1 PE=1 SV=2 173 404 6.0E-07
sp|Q9P2G3|KLH14_HUMAN Kelch-like protein 14 OS=Homo sapiens GN=KLHL14 PE=1 SV=2 236 404 6.0E-07
sp|Q3B7M1|KLH36_BOVIN Kelch-like protein 36 OS=Bos taurus GN=KLHL36 PE=2 SV=1 185 404 6.0E-07
sp|Q8N4N3|KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens GN=KLHL36 PE=1 SV=1 186 404 8.0E-07
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 149 371 9.0E-07
sp|Q684M4|KEAP1_PIG Kelch-like ECH-associated protein 1 OS=Sus scrofa GN=KEAP1 PE=3 SV=1 173 404 9.0E-07
sp|Q08CY1|KLH22_XENTR Kelch-like protein 22 OS=Xenopus tropicalis GN=klhl22 PE=2 SV=1 173 404 9.0E-07
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 100 314 1.0E-06
sp|Q25390|SCRA_LIMPO Alpha-scruin OS=Limulus polyphemus PE=2 SV=1 228 426 1.0E-06
sp|Q19981|TAG53_CAEEL Putative protein tag-53 OS=Caenorhabditis elegans GN=tag-53 PE=1 SV=3 210 473 1.0E-06
sp|Q99J86|ATRN_RAT Attractin OS=Rattus norvegicus GN=Atrn PE=2 SV=1 173 404 1.0E-06
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 171 371 1.0E-06
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 187 371 2.0E-06
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 166 245 2.0E-06
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 166 404 2.0E-06
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 166 245 2.0E-06
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 126 267 2.0E-06
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 196 388 2.0E-06
sp|P60882|MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus GN=Megf8 PE=1 SV=2 102 369 2.0E-06
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 114 371 2.0E-06
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 166 404 3.0E-06
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 164 353 3.0E-06
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 166 245 3.0E-06
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 166 404 3.0E-06
sp|Q25390|SCRA_LIMPO Alpha-scruin OS=Limulus polyphemus PE=2 SV=1 171 436 3.0E-06
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 181 374 4.0E-06
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 114 357 5.0E-06
sp|O35709|ENC1_MOUSE Ectoderm-neural cortex protein 1 OS=Mus musculus GN=Enc1 PE=2 SV=2 168 404 6.0E-06
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 795 1319 7.0E-06
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 212 353 8.0E-06
sp|O14682|ENC1_HUMAN Ectoderm-neural cortex protein 1 OS=Homo sapiens GN=ENC1 PE=1 SV=2 168 404 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6012
MAFLFKSKKSQDRALSSRDGNSGSQGSVQTVGTRTPRDEKSAVAQRSTPTGSLNSIDHDASAASPDQGHARRGGS
VDTTQQSDLPLRNGLPPTNPNASLYPWSQRRLTYSSSHSSPFPRYGAAVNALSSKEGDIYMMGGLINSSTVKGDL
WLIEAGGSMACYPLATTAEGPCPRVGHASLLVGNAFIVYGGDTKIKDSDVLDETLYLLNTSTRNWSLALPAGPRP
AGRYGHSLNILGSKIYIFGGQVEGSFMNDLSAFDLNQLQKPSNRWEILVPGEASTKVPAPRTNHSMVTYNDRMYL
FGGTNGFQWFNDVWCYDPSGNSWTQLDCIGYIPAPREGHAAALVDDVMYVFGGRTEEGSDLGDLAAFRISSRRWY
TFQNMGPSPSPRSGHSMTTVGKSIVVLGGEPSAAASTINDLGILYVLDTTKIRYPNDSQQTSQRAVQGRRPSGSE
VQSPVRQLQSRDGSTGPADQRKLIGPPPGAPPAVNGPPNGSKSVPPSGPPDVSGPPPSQAVPGAPTSKLPRAAAT
MSPTGLPPPQGPPPTRPPADAPSAGRVRGMSVDRSGASGSPQIRSAQSPVTREGGFDMDATAVNGRRTPTQPGRK
SHEQEVAAAADIAAKTKQPRHNQSQGSVDSTVDPSAKAPRPSSPPPPSRQTSNPSRRLSGRNSQTVALLKELDSS
RNRNAWYASELELARKAGYVTTAGFSPTLEAKATETFDDEDRPLVEALLAMRTELANVQSAVDKQAVIAAKQIAE
AEKQRDAAIQEAVYAKARIAAHGGSANSTPQLEGERGDVGDRAAEMSRKLATALNLQRNMQSQVESMRMELEAER
KARKLADDTAAVAQKRMSDLENYKQQTSTEVERLKAELHMVQREAREQSVSSAEAIAALELLRVEKAEMTSRYDR
AVDSSKDHGETFESLRSAIVASQDARAHLEKKAEDERLEREALQERFNKLKAEHDACVAELGAATQRLKDAEELA
KKHIEEARTHRQAVISGLDKISAREVPQSSPADTERLAGLQHQIASSNALVKKYKLEADSAADKLRSAEERIAGL
EQYQEQSSREGVAIRRQLQSSLRDVQSLQAAQAEVRNQLAAQQLEANAMTVQNKALKAILSERGISPTAAMRTRA
LASPRTASPEMGRVRELESQLASAAAAHEETKQAFAAQAQESELAYREKLSQLESDYQSAVHYVKGTEKMLKQLK
DQLTRYKSDNGRLKAEVEELENRIGGEATSREAPAEWESERSKLRKRTEDLESELRDAGAQLEKDLEKLKMELAE
SKRQRDEAVKSSEEAARSLSSQRRDLEQLQSTNSMLEQRASDAEQKVSLLLDQVENSVDNYRRRSRQIASMGSDT
VPGANGIDLGHIRTESSETVSGYGTAGTGSGTGGHGLDARNSAALDNLASELETLRSHWESTNKSYRLSSNFDFD
HAPAPARDDDDATASSGLSKSLADWRKRLDTDDVSHNGVDKTHSS
Coding >Ophio5|6012
ATGGCCTTTCTCTTCAAGTCCAAGAAGAGCCAGGACCGCGCCTTGTCGAGCCGCGACGGCAACTCGGGTTCGCAG
GGCTCCGTCCAGACTGTCGGCACACGCACTCCCCGCGATGAGAAGAGCGCGGTGGCGCAACGGTCGACGCCCACG
GGGAGCCTCAACTCGATCGACCACGATGCTTCCGCTGCGAGCCCCGATCAGGGCCATGCGCGCCGCGGGGGAAGC
GTCGACACCACCCAGCAGAGCGATTTACCGCTCCGGAATGGACTGCCGCCGACGAATCCAAACGCTTCGCTCTAT
CCGTGGTCGCAGCGCCGCTTGACTTACTCGTCATCCCACTCCAGCCCGTTTCCGCGATACGGTGCCGCTGTCAAT
GCGTTGTCGTCCAAGGAAGGTGACATCTACATGATGGGGGGCCTGATCAACAGTTCTACGGTCAAGGGCGACCTT
TGGCTGATTGAAGCTGGCGGAAGCATGGCTTGCTATCCCCTCGCCACCACGGCTGAGGGTCCTTGTCCGAGAGTC
GGACATGCCAGCCTGCTGGTCGGCAACGCCTTCATCGTTTACGGTGGCGACACCAAGATCAAGGACTCCGACGTG
CTTGACGAGACGCTTTACCTGCTTAATACCTCAACACGGAATTGGTCGCTAGCACTTCCCGCCGGCCCTCGGCCA
GCCGGCCGCTACGGGCATTCGCTGAACATTCTAGGATCGAAAATCTACATCTTCGGCGGCCAGGTCGAAGGTTCT
TTTATGAACGACCTCTCCGCCTTCGATCTCAACCAGCTGCAGAAGCCAAGCAACCGCTGGGAGATCTTGGTACCG
GGCGAGGCGTCGACCAAGGTTCCGGCTCCGCGAACGAACCATTCCATGGTCACGTACAACGACAGGATGTACCTT
TTCGGTGGTACCAACGGGTTTCAATGGTTCAACGATGTCTGGTGCTACGACCCGTCCGGCAACTCATGGACGCAG
CTGGATTGCATTGGCTACATCCCGGCCCCTCGGGAAGGACACGCGGCCGCTCTTGTCGACGATGTCATGTACGTC
TTCGGCGGCCGTACTGAGGAAGGCAGCGACTTGGGTGATCTCGCGGCGTTCAGGATATCGTCGCGCCGGTGGTAC
ACATTTCAAAACATGGGCCCCTCCCCGTCGCCTCGGTCCGGTCACAGCATGACGACGGTGGGAAAATCGATTGTG
GTGCTCGGCGGTGAACCCAGCGCTGCCGCCTCCACCATCAACGACCTTGGCATTCTCTACGTCTTGGATACGACT
AAGATTCGATATCCCAATGACAGTCAGCAGACTTCGCAGAGGGCTGTCCAGGGTCGGCGGCCGAGCGGGAGCGAA
GTCCAGAGCCCCGTTCGGCAGCTGCAGTCTCGAGATGGGTCGACGGGGCCGGCGGACCAGCGGAAACTGATCGGT
CCCCCCCCTGGCGCGCCCCCGGCCGTCAATGGTCCTCCGAATGGATCCAAGTCGGTTCCGCCGAGCGGGCCCCCG
GACGTCAGCGGCCCGCCGCCGAGCCAGGCGGTGCCCGGAGCGCCGACATCCAAGCTTCCGCGTGCCGCCGCAACT
ATGAGCCCTACCGGGCTGCCGCCTCCGCAAGGTCCGCCGCCGACGAGGCCTCCCGCGGACGCTCCCAGCGCAGGT
CGGGTGCGTGGCATGTCGGTCGATCGCAGCGGTGCTTCGGGCTCGCCCCAGATCAGGTCGGCTCAGTCTCCTGTG
ACCCGTGAGGGCGGATTTGACATGGATGCCACCGCCGTCAACGGCCGCCGAACGCCGACGCAGCCGGGGAGGAAA
AGTCACGAGCAAGAGGTGGCAGCCGCAGCTGACATTGCTGCCAAGACGAAGCAGCCTCGTCACAACCAGTCCCAG
GGCTCCGTGGACAGCACAGTGGACCCGTCCGCCAAAGCGCCACGGCCGTCATCACCGCCTCCCCCGAGTCGACAG
ACGAGCAATCCCTCTAGGCGTCTGTCTGGCCGCAATTCGCAGACGGTTGCCCTGCTCAAGGAGCTCGACTCGTCT
CGCAATAGGAACGCGTGGTATGCCTCTGAGCTGGAGCTGGCTCGAAAGGCAGGCTATGTCACTACCGCCGGCTTC
AGCCCAACGCTCGAGGCCAAGGCGACGGAGACCTTTGACGACGAGGACCGCCCGCTTGTCGAGGCTCTACTGGCG
ATGCGTACCGAGCTGGCCAACGTGCAGAGCGCCGTGGACAAGCAGGCGGTCATTGCCGCCAAGCAAATCGCCGAG
GCCGAGAAGCAGCGGGACGCGGCCATCCAGGAGGCCGTCTATGCCAAAGCCAGGATAGCCGCTCACGGCGGCAGC
GCGAATAGCACCCCCCAGCTCGAGGGCGAACGCGGCGACGTCGGCGATAGGGCTGCCGAGATGAGCCGGAAGCTT
GCTACCGCCCTGAATCTTCAAAGGAACATGCAGTCGCAGGTGGAGAGCATGAGAATGGAGCTCGAGGCCGAACGC
AAAGCTCGGAAGCTGGCGGACGACACGGCAGCCGTGGCCCAGAAGCGCATGAGCGACCTGGAGAACTACAAGCAG
CAGACGTCGACCGAGGTCGAGCGGTTAAAGGCGGAGCTGCACATGGTACAGCGTGAAGCGCGTGAGCAGTCAGTG
TCCAGCGCCGAGGCCATCGCCGCGCTGGAGCTGCTTAGGGTCGAGAAGGCGGAAATGACAAGCAGGTATGACAGG
GCCGTGGACAGCTCCAAGGATCACGGCGAGACTTTCGAGTCCCTCCGCAGCGCCATAGTGGCGTCGCAGGATGCC
AGGGCACACCTGGAGAAGAAGGCGGAAGACGAGCGACTGGAGAGAGAGGCGCTTCAGGAAAGGTTTAACAAACTC
AAGGCCGAACACGACGCGTGCGTGGCGGAACTGGGCGCGGCCACGCAGCGGCTCAAAGACGCCGAAGAGCTGGCC
AAGAAGCACATCGAAGAGGCGAGAACCCATCGACAGGCCGTCATCTCCGGACTCGATAAGATCTCGGCCCGAGAA
GTTCCTCAGTCGAGCCCGGCGGATACGGAGCGTCTCGCCGGGCTTCAACACCAGATTGCCTCGTCGAATGCGTTG
GTCAAGAAGTACAAGTTGGAGGCAGATTCGGCGGCCGACAAGCTGCGCAGCGCCGAGGAGCGCATCGCCGGGCTG
GAGCAGTACCAAGAACAATCCAGTCGGGAGGGCGTCGCGATACGGCGCCAACTGCAGTCCTCGCTGAGGGACGTG
CAAAGCTTGCAAGCGGCACAGGCTGAGGTGAGGAACCAGCTGGCGGCCCAGCAGCTGGAGGCGAACGCGATGACG
GTCCAGAACAAGGCGCTCAAGGCCATCCTCAGCGAGCGAGGCATCAGCCCTACGGCGGCGATGCGAACCCGGGCC
CTGGCGAGCCCGCGGACGGCGTCTCCGGAAATGGGCCGGGTGCGAGAGCTGGAGTCGCAGCTCGCCAGCGCGGCG
GCCGCTCACGAGGAGACGAAGCAGGCCTTTGCGGCGCAGGCGCAGGAATCGGAGCTGGCCTATCGCGAGAAGCTC
TCACAGCTCGAGAGCGACTACCAGTCGGCCGTCCACTACGTCAAGGGGACGGAGAAGATGCTTAAGCAGCTCAAG
GATCAGTTGACGCGTTACAAGTCGGATAACGGACGGCTCAAGGCCGAGGTCGAGGAGCTCGAGAACCGGATCGGC
GGCGAGGCGACGTCACGGGAAGCCCCGGCCGAGTGGGAAAGCGAACGCAGCAAACTGCGCAAGAGGACGGAAGAC
CTGGAGAGCGAGCTGCGAGACGCAGGCGCCCAGCTGGAGAAGGACCTCGAGAAGCTCAAGATGGAGCTGGCCGAG
AGCAAGCGGCAGCGGGACGAGGCCGTCAAGAGCAGCGAGGAGGCCGCCAGGAGCTTGAGCTCGCAGCGAAGGGAC
CTGGAGCAGCTTCAGTCGACCAACTCGATGCTCGAGCAGCGGGCATCCGACGCGGAGCAAAAGGTGTCGCTGCTG
CTGGACCAAGTGGAGAACTCGGTGGACAACTACCGGCGACGCAGCCGACAGATCGCCAGCATGGGCTCCGACACG
GTTCCCGGCGCCAACGGGATCGACCTCGGTCACATCCGGACGGAGAGCTCGGAAACGGTGAGCGGATACGGCACA
GCTGGTACTGGATCCGGCACCGGAGGACACGGCCTCGACGCCCGAAACAGCGCCGCGCTCGACAACCTCGCCTCG
GAGCTGGAGACGCTCCGTAGCCACTGGGAGTCGACCAACAAGAGCTACAGGCTGAGCTCCAACTTTGACTTTGAT
CATGCCCCGGCCCCGGCCAGAGACGATGACGACGCTACGGCCAGCTCCGGCCTCAGTAAGAGCCTGGCTGATTGG
AGGAAGAGGCTCGACACTGATGACGTGTCTCACAATGGCGTTGACAAGACGCACTCGAGC
Transcript >Ophio5|6012
ATGGCCTTTCTCTTCAAGTCCAAGAAGAGCCAGGACCGCGCCTTGTCGAGCCGCGACGGCAACTCGGGTTCGCAG
GGCTCCGTCCAGACTGTCGGCACACGCACTCCCCGCGATGAGAAGAGCGCGGTGGCGCAACGGTCGACGCCCACG
GGGAGCCTCAACTCGATCGACCACGATGCTTCCGCTGCGAGCCCCGATCAGGGCCATGCGCGCCGCGGGGGAAGC
GTCGACACCACCCAGCAGAGCGATTTACCGCTCCGGAATGGACTGCCGCCGACGAATCCAAACGCTTCGCTCTAT
CCGTGGTCGCAGCGCCGCTTGACTTACTCGTCATCCCACTCCAGCCCGTTTCCGCGATACGGTGCCGCTGTCAAT
GCGTTGTCGTCCAAGGAAGGTGACATCTACATGATGGGGGGCCTGATCAACAGTTCTACGGTCAAGGGCGACCTT
TGGCTGATTGAAGCTGGCGGAAGCATGGCTTGCTATCCCCTCGCCACCACGGCTGAGGGTCCTTGTCCGAGAGTC
GGACATGCCAGCCTGCTGGTCGGCAACGCCTTCATCGTTTACGGTGGCGACACCAAGATCAAGGACTCCGACGTG
CTTGACGAGACGCTTTACCTGCTTAATACCTCAACACGGAATTGGTCGCTAGCACTTCCCGCCGGCCCTCGGCCA
GCCGGCCGCTACGGGCATTCGCTGAACATTCTAGGATCGAAAATCTACATCTTCGGCGGCCAGGTCGAAGGTTCT
TTTATGAACGACCTCTCCGCCTTCGATCTCAACCAGCTGCAGAAGCCAAGCAACCGCTGGGAGATCTTGGTACCG
GGCGAGGCGTCGACCAAGGTTCCGGCTCCGCGAACGAACCATTCCATGGTCACGTACAACGACAGGATGTACCTT
TTCGGTGGTACCAACGGGTTTCAATGGTTCAACGATGTCTGGTGCTACGACCCGTCCGGCAACTCATGGACGCAG
CTGGATTGCATTGGCTACATCCCGGCCCCTCGGGAAGGACACGCGGCCGCTCTTGTCGACGATGTCATGTACGTC
TTCGGCGGCCGTACTGAGGAAGGCAGCGACTTGGGTGATCTCGCGGCGTTCAGGATATCGTCGCGCCGGTGGTAC
ACATTTCAAAACATGGGCCCCTCCCCGTCGCCTCGGTCCGGTCACAGCATGACGACGGTGGGAAAATCGATTGTG
GTGCTCGGCGGTGAACCCAGCGCTGCCGCCTCCACCATCAACGACCTTGGCATTCTCTACGTCTTGGATACGACT
AAGATTCGATATCCCAATGACAGTCAGCAGACTTCGCAGAGGGCTGTCCAGGGTCGGCGGCCGAGCGGGAGCGAA
GTCCAGAGCCCCGTTCGGCAGCTGCAGTCTCGAGATGGGTCGACGGGGCCGGCGGACCAGCGGAAACTGATCGGT
CCCCCCCCTGGCGCGCCCCCGGCCGTCAATGGTCCTCCGAATGGATCCAAGTCGGTTCCGCCGAGCGGGCCCCCG
GACGTCAGCGGCCCGCCGCCGAGCCAGGCGGTGCCCGGAGCGCCGACATCCAAGCTTCCGCGTGCCGCCGCAACT
ATGAGCCCTACCGGGCTGCCGCCTCCGCAAGGTCCGCCGCCGACGAGGCCTCCCGCGGACGCTCCCAGCGCAGGT
CGGGTGCGTGGCATGTCGGTCGATCGCAGCGGTGCTTCGGGCTCGCCCCAGATCAGGTCGGCTCAGTCTCCTGTG
ACCCGTGAGGGCGGATTTGACATGGATGCCACCGCCGTCAACGGCCGCCGAACGCCGACGCAGCCGGGGAGGAAA
AGTCACGAGCAAGAGGTGGCAGCCGCAGCTGACATTGCTGCCAAGACGAAGCAGCCTCGTCACAACCAGTCCCAG
GGCTCCGTGGACAGCACAGTGGACCCGTCCGCCAAAGCGCCACGGCCGTCATCACCGCCTCCCCCGAGTCGACAG
ACGAGCAATCCCTCTAGGCGTCTGTCTGGCCGCAATTCGCAGACGGTTGCCCTGCTCAAGGAGCTCGACTCGTCT
CGCAATAGGAACGCGTGGTATGCCTCTGAGCTGGAGCTGGCTCGAAAGGCAGGCTATGTCACTACCGCCGGCTTC
AGCCCAACGCTCGAGGCCAAGGCGACGGAGACCTTTGACGACGAGGACCGCCCGCTTGTCGAGGCTCTACTGGCG
ATGCGTACCGAGCTGGCCAACGTGCAGAGCGCCGTGGACAAGCAGGCGGTCATTGCCGCCAAGCAAATCGCCGAG
GCCGAGAAGCAGCGGGACGCGGCCATCCAGGAGGCCGTCTATGCCAAAGCCAGGATAGCCGCTCACGGCGGCAGC
GCGAATAGCACCCCCCAGCTCGAGGGCGAACGCGGCGACGTCGGCGATAGGGCTGCCGAGATGAGCCGGAAGCTT
GCTACCGCCCTGAATCTTCAAAGGAACATGCAGTCGCAGGTGGAGAGCATGAGAATGGAGCTCGAGGCCGAACGC
AAAGCTCGGAAGCTGGCGGACGACACGGCAGCCGTGGCCCAGAAGCGCATGAGCGACCTGGAGAACTACAAGCAG
CAGACGTCGACCGAGGTCGAGCGGTTAAAGGCGGAGCTGCACATGGTACAGCGTGAAGCGCGTGAGCAGTCAGTG
TCCAGCGCCGAGGCCATCGCCGCGCTGGAGCTGCTTAGGGTCGAGAAGGCGGAAATGACAAGCAGGTATGACAGG
GCCGTGGACAGCTCCAAGGATCACGGCGAGACTTTCGAGTCCCTCCGCAGCGCCATAGTGGCGTCGCAGGATGCC
AGGGCACACCTGGAGAAGAAGGCGGAAGACGAGCGACTGGAGAGAGAGGCGCTTCAGGAAAGGTTTAACAAACTC
AAGGCCGAACACGACGCGTGCGTGGCGGAACTGGGCGCGGCCACGCAGCGGCTCAAAGACGCCGAAGAGCTGGCC
AAGAAGCACATCGAAGAGGCGAGAACCCATCGACAGGCCGTCATCTCCGGACTCGATAAGATCTCGGCCCGAGAA
GTTCCTCAGTCGAGCCCGGCGGATACGGAGCGTCTCGCCGGGCTTCAACACCAGATTGCCTCGTCGAATGCGTTG
GTCAAGAAGTACAAGTTGGAGGCAGATTCGGCGGCCGACAAGCTGCGCAGCGCCGAGGAGCGCATCGCCGGGCTG
GAGCAGTACCAAGAACAATCCAGTCGGGAGGGCGTCGCGATACGGCGCCAACTGCAGTCCTCGCTGAGGGACGTG
CAAAGCTTGCAAGCGGCACAGGCTGAGGTGAGGAACCAGCTGGCGGCCCAGCAGCTGGAGGCGAACGCGATGACG
GTCCAGAACAAGGCGCTCAAGGCCATCCTCAGCGAGCGAGGCATCAGCCCTACGGCGGCGATGCGAACCCGGGCC
CTGGCGAGCCCGCGGACGGCGTCTCCGGAAATGGGCCGGGTGCGAGAGCTGGAGTCGCAGCTCGCCAGCGCGGCG
GCCGCTCACGAGGAGACGAAGCAGGCCTTTGCGGCGCAGGCGCAGGAATCGGAGCTGGCCTATCGCGAGAAGCTC
TCACAGCTCGAGAGCGACTACCAGTCGGCCGTCCACTACGTCAAGGGGACGGAGAAGATGCTTAAGCAGCTCAAG
GATCAGTTGACGCGTTACAAGTCGGATAACGGACGGCTCAAGGCCGAGGTCGAGGAGCTCGAGAACCGGATCGGC
GGCGAGGCGACGTCACGGGAAGCCCCGGCCGAGTGGGAAAGCGAACGCAGCAAACTGCGCAAGAGGACGGAAGAC
CTGGAGAGCGAGCTGCGAGACGCAGGCGCCCAGCTGGAGAAGGACCTCGAGAAGCTCAAGATGGAGCTGGCCGAG
AGCAAGCGGCAGCGGGACGAGGCCGTCAAGAGCAGCGAGGAGGCCGCCAGGAGCTTGAGCTCGCAGCGAAGGGAC
CTGGAGCAGCTTCAGTCGACCAACTCGATGCTCGAGCAGCGGGCATCCGACGCGGAGCAAAAGGTGTCGCTGCTG
CTGGACCAAGTGGAGAACTCGGTGGACAACTACCGGCGACGCAGCCGACAGATCGCCAGCATGGGCTCCGACACG
GTTCCCGGCGCCAACGGGATCGACCTCGGTCACATCCGGACGGAGAGCTCGGAAACGGTGAGCGGATACGGCACA
GCTGGTACTGGATCCGGCACCGGAGGACACGGCCTCGACGCCCGAAACAGCGCCGCGCTCGACAACCTCGCCTCG
GAGCTGGAGACGCTCCGTAGCCACTGGGAGTCGACCAACAAGAGCTACAGGCTGAGCTCCAACTTTGACTTTGAT
CATGCCCCGGCCCCGGCCAGAGACGATGACGACGCTACGGCCAGCTCCGGCCTCAGTAAGAGCCTGGCTGATTGG
AGGAAGAGGCTCGACACTGATGACGTGTCTCACAATGGCGTTGACAAGACGCACTCGAGCTGA
Gene >Ophio5|6012
ATGGCCTTTCTCTTCAAGTCCAAGAAGAGCCAGGACCGCGCCTTGTCGAGCCGCGACGGCAACTCGGGTTCGCAG
GGCTCCGTCCAGACTGTCGGCACACGCACTCCCCGCGATGAGAAGAGCGCGGTGGCGCAACGGTCGACGCCCACG
GGGAGCCTCAACTCGATCGACCACGATGCTTCCGCTGCGAGCCCCGATCAGGGCCATGCGCGCCGCGGGGGAAGC
GTCGACACCACCCAGCAGAGCGATTTACCGGTGAGTGGCGCCGAAGGAAAAAAAAAAAGCCTTCCTCCTGGTTCC
CCCTTCGTTCGCCCTCTGACCTACGCTCGACAGCTCCGGAATGGACTGCCGCCGACGAATCCAAACGCTTCGCTC
TATCCGTGGTCGCAGCGCCGCTTGACTTACTCGTCATCCCACTCCAGCCCGTTTCCGCGATACGGTGCCGCTGTC
AATGCGTTGTCGTCCAAGGAAGGTGACATCTACATGATGGGGGGCCTGATCAACAGTTCTACGGTCAAGGGCGAC
CTTTGGCTGATTGAAGCTGGCGGAAGCATGGCTTGCTATCCCCTCGCCACCACGGCTGAGGGTCCTTGTCCGAGA
GTCGGACATGCCAGCCTGCTGGTCGGCAACGCCTTCATCGTTTACGGTGGCGACACCAAGATCAAGGACTCCGAC
GTGCTTGACGAGACGCTTTACCTGCTTAATACCTGTAAGTATACGGCGCCATGATAGCTTGTGCCTCGGACTGAC
GGAGACTCTCCTAGCAACACGGAATTGGTCGCTAGCACTTCCCGCCGGCCCTCGGCCAGCCGGCCGCTACGGGCA
TTCGCTGAACATTCTAGGATCGAAAATCTACATCTTCGGCGGCCAGGTCGAAGGTTCTTTTATGAACGACCTCTC
CGCCTTCGATCTCAACCAGCTGCAGAAGCCAAGCAACCGCTGGGAGATCTTGGTACCGGGCGAGGCGTCGACCAA
GGTTCCGGCTCCGCGAACGAACCATTCCATGGTCACGTACAACGACAGGATGTACCTGTGAGCGTTTTGAGAATC
CCCTATCCTCCCCGCATTGACTGACCCTGCCAGTTTCGGTGGTACCAACGGGTTTCAATGGTTCAACGATGTCTG
GTGCTACGACCCGTCCGGCAACTCATGGACGCAGCTGGATTGCATTGGCTACATCCCGGCCCCTCGGGAAGGACA
CGCGGCCGCTCTTGTCGACGATGTCATGTACGTCTTCGGCGGCCGTACTGAGGAAGGCAGCGACTTGGGTGATCT
CGCGGCGTTCAGGATATCGTCGCGCCGGTGGTACACATTTCAAAACATGGGCCCCTCCCCGTCGCCTCGGTCCGG
TCACAGCATGACGACGGTGGGAAAATCGATTGTGGTGCTCGGCGGTGAACCCAGCGCTGCCGCCTCCACCATCAA
CGACCTTGGCATTCTCTACGTCTTGGATACGACTAAGATTCGATATCCCAATGACAGTCAGCAGACTTCGCAGAG
GGCTGTCCAGGGTCGGCGGCCGAGCGGGAGCGAAGTCCAGAGCCCCGTTCGGCAGCTGCAGTCTCGAGATGGGTC
GACGGGGCCGGCGGACCAGCGGAAACTGATCGGTCCCCCCCCTGGCGCGCCCCCGGCCGTCAATGGTCCTCCGAA
TGGATCCAAGTCGGTTCCGCCGAGCGGGCCCCCGGACGTCAGCGGCCCGCCGCCGAGCCAGGCGGTGCCCGGAGC
GCCGACATCCAAGCTTCCGCGTGCCGCCGCAACTATGAGCCCTACCGGGCTGCCGCCTCCGCAAGGTCCGCCGCC
GACGAGGCCTCCCGCGGACGCTCCCAGCGCAGGTCGGGTGCGTGGCATGTCGGTCGATCGCAGCGGTGCTTCGGG
CTCGCCCCAGATCAGGTCGGCTCAGTCTCCTGTGACCCGTGAGGGCGGATTTGACATGGATGCCACCGCCGTCAA
CGGCCGCCGAACGCCGACGCAGCCGGGGAGGAAAAGTCACGAGCAAGAGGTGGCAGCCGCAGCTGACATTGCTGC
CAAGACGAAGCAGCCTCGTCACAACCAGTCCCAGGGCTCCGTGGACAGCACAGTGGACCCGTCCGCCAAAGCGCC
ACGGCCGTCATCACCGCCTCCCCCGAGTCGACAGACGAGCAATCCCTCTAGGCGTCTGTCTGGCCGCAATTCGCA
GACGGTTGCCCTGCTCAAGGAGCTCGACTCGTCTCGCAATAGGAACGCGTGGTATGCCTCTGAGCTGGAGCTGGC
TCGAAAGGCAGGCTATGTCACTACCGCCGGCTTCAGCCCAACGCTCGAGGCCAAGGCGACGGAGACCTTTGACGA
CGAGGACCGCCCGCTTGTCGAGGCTCTACTGGCGATGCGTACCGAGCTGGCCAACGTGCAGAGCGCCGTGGACAA
GCAGGCGGTCATTGCCGCCAAGCAAATCGCCGAGGCCGAGAAGCAGCGGGACGCGGCCATCCAGGAGGCCGTCTA
TGCCAAAGCCAGGATAGCCGCTCACGGCGGCAGCGCGAATAGCACCCCCCAGCTCGAGGGCGAACGCGGCGACGT
CGGCGATAGGGCTGCCGAGATGAGCCGGAAGCTTGCTACCGCCCTGAATCTTCAAAGGAACATGCAGTCGCAGGT
GGAGAGCATGAGAATGGAGCTCGAGGCCGAACGCAAAGCTCGGAAGCTGGCGGACGACACGGCAGCCGTGGCCCA
GAAGCGCATGAGCGACCTGGAGAACTACAAGCAGCAGACGTCGACCGAGGTCGAGCGGTTAAAGGCGGAGCTGCA
CATGGTACAGCGTGAAGCGCGTGAGCAGTCAGTGTCCAGCGCCGAGGCCATCGCCGCGCTGGAGCTGCTTAGGGT
CGAGAAGGCGGAAATGACAAGCAGGTATGACAGGGCCGTGGACAGCTCCAAGGATCACGGCGAGACTTTCGAGTC
CCTCCGCAGCGCCATAGTGGCGTCGCAGGATGCCAGGGCACACCTGGAGAAGAAGGCGGAAGACGAGCGACTGGA
GAGAGAGGCGCTTCAGGAAAGGTTTAACAAACTCAAGGCCGAACACGACGCGTGCGTGGCGGAACTGGGCGCGGC
CACGCAGCGGCTCAAAGACGCCGAAGAGCTGGCCAAGAAGCACATCGAAGAGGCGAGAACCCATCGACAGGCCGT
CATCTCCGGACTCGATAAGATCTCGGCCCGAGAAGTTCCTCAGTCGAGCCCGGCGGATACGGAGCGTCTCGCCGG
GCTTCAACACCAGATTGCCTCGTCGAATGCGTTGGTCAAGAAGTACAAGTTGGAGGCAGATTCGGCGGCCGACAA
GCTGCGCAGCGCCGAGGAGCGCATCGCCGGGCTGGAGCAGTACCAAGAACAATCCAGTCGGGAGGGCGTCGCGAT
ACGGCGCCAACTGCAGTCCTCGCTGAGGGACGTGCAAAGCTTGCAAGCGGCACAGGCTGAGGTGAGGAACCAGCT
GGCGGCCCAGCAGCTGGAGGCGAACGCGATGACGGTCCAGAACAAGGCGCTCAAGGCCATCCTCAGCGAGCGAGG
CATCAGCCCTACGGCGGCGATGCGAACCCGGGCCCTGGCGAGCCCGCGGACGGCGTCTCCGGAAATGGGCCGGGT
GCGAGAGCTGGAGTCGCAGCTCGCCAGCGCGGCGGCCGCTCACGAGGAGACGAAGCAGGCCTTTGCGGCGCAGGC
GCAGGAATCGGAGCTGGCCTATCGCGAGAAGCTCTCACAGCTCGAGAGCGACTACCAGTCGGCCGTCCACTACGT
CAAGGGGACGGAGAAGATGCTTAAGCAGCTCAAGGATCAGTTGACGCGTTACAAGTCGGATAACGGACGGCTCAA
GGCCGAGGTCGAGGAGCTCGAGAACCGGATCGGCGGCGAGGCGACGTCACGGGAAGCCCCGGCCGAGTGGGAAAG
CGAACGCAGCAAACTGCGCAAGAGGACGGAAGACCTGGAGAGCGAGCTGCGAGACGCAGGCGCCCAGCTGGAGAA
GGACCTCGAGAAGCTCAAGATGGAGCTGGCCGAGAGCAAGCGGCAGCGGGACGAGGCCGTCAAGAGCAGCGAGGA
GGCCGCCAGGAGCTTGAGCTCGCAGCGAAGGGACCTGGAGCAGCTTCAGTCGACCAACTCGATGCTCGAGCAGCG
GGCATCCGACGCGGAGCAAAAGGTGTCGCTGCTGCTGGACCAAGTGGAGAACTCGGTGGACAACTACCGGCGACG
CAGCCGACAGATCGCCAGCATGGGCTCCGACACGGTTCCCGGCGCCAACGGGATCGACCTCGGTCACATCCGGAC
GGAGAGCTCGGAAACGGTGAGCGGATACGGCACAGCTGGTACTGGATCCGGCACCGGAGGACACGGCCTCGACGC
CCGAAACAGCGCCGCGCTCGACAACCTCGCCTCGGAGCTGGAGACGCTCCGTAGCCACTGGGAGTCGACCAACAA
GAGCTACAGGCTGAGCTCCAACTTTGACTTTGATCATGCCCCGGCCCCGGCCAGAGACGATGACGACGCTACGGC
CAGCTCCGGCCTCAGTAAGAGCCTGGCTGATTGGAGGAAGAGGCTCGACACTGATGACGTGTCTCACAATGGCGT
TGACAAGACGCACTCGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail