Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6003
Gene name
Locationscaffold_506:5875..8969
Strand+
Gene length (bp)3094
Transcript length (bp)2727
Coding sequence length (bp)2724
Protein length (aa) 908

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 2.5E-73 240 402
PF08407 Chitin_synth_1N Chitin synthase N-terminal 1.4E-27 168 239
PF03142 Chitin_synth_2 Chitin synthase 6.9E-17 380 555

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 125 907 0.0E+00
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 21 908 0.0E+00
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 150 900 0.0E+00
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 27 900 0.0E+00
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 99 900 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 125 907 0.0E+00
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 21 908 0.0E+00
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 150 900 0.0E+00
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 27 900 0.0E+00
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 99 900 0.0E+00
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 35 858 0.0E+00
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 135 903 0.0E+00
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 117 900 0.0E+00
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 175 901 0.0E+00
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 147 906 0.0E+00
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 145 905 0.0E+00
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 149 908 0.0E+00
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 146 908 0.0E+00
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 157 908 0.0E+00
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 111 907 0.0E+00
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 143 905 0.0E+00
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 13 904 0.0E+00
sp|P30572|CHS2_CANAX Chitin synthase 2 OS=Candida albicans GN=CHS2 PE=2 SV=2 140 908 0.0E+00
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 162 907 0.0E+00
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 162 907 0.0E+00
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 140 907 0.0E+00
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 119 907 0.0E+00
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 155 907 0.0E+00
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 49 904 0.0E+00
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 1 904 0.0E+00
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 1 908 0.0E+00
sp|O74756|CHS2_SCHPO Chitin synthase-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs2 PE=3 SV=1 168 908 5.0E-120
sp|P49603|CHS1_BOTFU Chitin synthase 1 (Fragment) OS=Botryotinia fuckeliana GN=chs1 PE=3 SV=1 245 433 6.0E-108
sp|P30576|CHS1_AJECA Chitin synthase 1 (Fragment) OS=Ajellomyces capsulatus GN=CHS1 PE=3 SV=1 245 431 9.0E-103
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 195 798 6.0E-101
sp|P30579|CHS1_AJEDE Chitin synthase 1 (Fragment) OS=Ajellomyces dermatitidis GN=CHS1 PE=3 SV=1 247 433 7.0E-101
sp|P30590|CHS1_EXOEX Chitin synthase 1 (Fragment) OS=Exophiala exophialae GN=CHS1 PE=3 SV=1 245 433 1.0E-100
sp|P30592|CHS1_RHIAT Chitin synthase 1 (Fragment) OS=Rhinocladiella atrovirens GN=CHS1 PE=3 SV=1 245 433 2.0E-100
sp|P30585|CHS1_EXOJE Chitin synthase 1 (Fragment) OS=Exophiala jeanselmei GN=CHS1 PE=3 SV=1 245 433 2.0E-100
sp|P30581|CHS1_ASPNG Chitin synthase 1 (Fragment) OS=Aspergillus niger GN=chs1 PE=3 SV=1 245 432 2.0E-99
sp|P30603|CHS1_XYLBA Chitin synthase 1 (Fragment) OS=Xylohypha bantiana GN=CHS1 PE=3 SV=1 245 433 1.0E-94
sp|P30596|CHS1_SCHCO Chitin synthase 1 (Fragment) OS=Schizophyllum commune GN=CHS1 PE=3 SV=1 247 432 7.0E-75
sp|P30591|CHS2_EXOEX Chitin synthase 2 (Fragment) OS=Exophiala exophialae GN=CHS2 PE=3 SV=2 245 433 2.0E-68
sp|P30586|CHS2_EXOJE Chitin synthase 2 (Fragment) OS=Exophiala jeanselmei GN=CHS2 PE=3 SV=2 245 432 2.0E-68
sp|P30582|CHS2_ASPNG Chitin synthase 2 (Fragment) OS=Aspergillus niger GN=chs2 PE=3 SV=1 245 433 5.0E-68
sp|P30580|CHS2_AJEDE Chitin synthase 2 (Fragment) OS=Ajellomyces dermatitidis GN=CHS2 PE=3 SV=1 245 433 2.0E-67
sp|P30578|CHS3_AJECA Chitin synthase 3 (Fragment) OS=Ajellomyces capsulatus GN=CHS3 PE=3 SV=1 245 433 1.0E-66
sp|P55003|CHS1_TUBUN Chitin synthase 1 (Fragment) OS=Tuber uncinatum GN=CHS1 PE=3 SV=1 248 433 3.0E-66
sp|P30604|CHS2_XYLBA Chitin synthase 2 (Fragment) OS=Xylohypha bantiana GN=CHS2 PE=3 SV=1 245 433 2.0E-62
sp|P30577|CHS2_AJECA Chitin synthase 2 (Fragment) OS=Ajellomyces capsulatus GN=CHS2 PE=3 SV=1 246 432 3.0E-55
sp|P30593|CHS2_RHIAT Chitin synthase 2 (Fragment) OS=Rhinocladiella atrovirens GN=CHS2 PE=3 SV=1 246 432 7.0E-54
sp|P30587|CHS3_EXOJE Chitin synthase 3 (Fragment) OS=Exophiala jeanselmei GN=CHS3 PE=3 SV=1 262 433 1.0E-49
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 380 555 6.0E-11
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 379 555 2.0E-10
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 380 763 2.0E-10
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 379 554 3.0E-10
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 382 554 1.0E-09
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 382 554 4.0E-09
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 380 554 7.0E-09
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 368 613 3.0E-08
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 412 554 4.0E-07
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 384 554 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004100 chitin synthase activity Yes
GO:0006031 chitin biosynthetic process Yes
GO:0016740 transferase activity No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No
GO:1901071 glucosamine-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0006040 amino sugar metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0046349 amino sugar biosynthetic process No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0006022 aminoglycan metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0006030 chitin metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 583 605 22
2 625 647 22
3 662 684 22
4 703 725 22
5 735 754 19
6 834 856 22
7 880 902 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 94.90 48.12 141.68
CcL In ants, during behavior modification 97.85 47.54 148.16
CcD In ants, recently dead 82.02 42.35 121.69

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.919628 no
SC16a CcD 0.584764 no
CcL CcD 0.509177 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6003
MSYDRLDNGYYHDAMDSRHGRPYRTPSPGQPLQQGYQLDDSPYGQQRLTPGPPGHLQRLGTPSDQLNIVAAQTVE
NLPYSGSRHQQGYGDAVVNPQLIHDEYGGTHSKYPSQDGAYFDPPTHGYDLDDRRPMLDHQSSSGYEDPYHDHPQ
QRLQQQASGALRRWKTVKQVLLYRGNLVLDCPVPPVLLQQNQHGERDEFTHMRYSAATCDPSEFYNENFTLRQKL
FSKPRHTELFIVITMYNEDDILFARTLIGVFKNIEYMCNRPNSKTWGNEAWKKIVVCVVSDGRAKINPRTKAVLS
GMGVYQEGIAKQQVNNKDVTAHIYEYTTQTHLQLKNDTITLVHRRRPVQMIFCLKEKNQKKINSHRWFFQAFGRV
LDPNICVLLDAGTRPGGNSIYHLWKAFDLEPMCGGACGEIKAMLGTGGKNLLNPLVATQNFEYKMSNILDKPLES
AFGFISVLPGAFSAYRYVALQNDKNGKGPLEKYFLGETLHGGSNAGLFESNMYLAEDRILCFELVTKRNCHWILQ
YVKSANGETDVPDSVTELVLQRRRWLNGSFFAAIYAIAHFHEFFRSNHSIFRKLGFFIEFVFQTINMIFAWFAIG
NFFLVFKILTTSLGSNDLLGRVGEILSVVFTWLYGVILITCFVLSMGNRPAGSGRLYTAMVWFWAGIMIYLLFAA
IFIAVKAIIADVNDADGFNIRQLFTNQVFYTLIVSVMSTYGIWLLASLIMFDPWHMITSFVQYMLLSPTYTNVLN
VYAFCNTHDVSWGTKGDDTVEKLPSVNTKDGQGKTDLPDEGDLNAQYQREVALFSAKYKAVKTKPTAAQLQEKQL
DYYRGVRTGVVLIWMITNFALAALVLSSAGLEKITPGRGSQADEEKARANLYMAIVLWSVAVLSGFKFLGAMWFL
IVRLFRGV
Coding >Ophio5|6003
ATGTCGTACGATCGCCTCGACAACGGCTACTACCACGACGCCATGGACTCCCGTCACGGACGTCCGTATCGGACA
CCGTCTCCCGGCCAGCCGCTGCAGCAGGGATACCAACTCGACGACAGCCCCTATGGCCAGCAGCGCCTCACTCCG
GGCCCACCAGGCCATCTTCAACGCCTGGGAACCCCAAGCGACCAATTGAATATAGTTGCTGCCCAAACCGTTGAA
AACCTTCCGTATTCGGGCTCCCGCCACCAACAGGGGTACGGGGACGCCGTCGTCAACCCTCAACTCATCCACGAC
GAGTACGGGGGCACGCATTCAAAGTATCCCTCACAGGACGGCGCCTACTTCGACCCCCCGACCCACGGCTACGAC
CTCGACGACCGCCGGCCCATGCTGGATCATCAGAGCTCGTCGGGCTACGAGGACCCATACCATGACCACCCACAG
CAGCGGCTGCAGCAGCAGGCCTCTGGGGCCCTGAGGCGCTGGAAGACGGTCAAGCAGGTGCTGCTCTACCGCGGC
AACCTGGTCCTCGACTGTCCCGTGCCGCCCGTTCTCCTGCAGCAAAACCAGCACGGCGAGCGCGACGAGTTCACC
CACATGCGGTACTCGGCCGCCACTTGCGACCCGTCCGAGTTTTACAACGAGAACTTTACCCTCCGGCAGAAGCTG
TTCAGCAAACCGCGCCATACCGAACTCTTCATCGTCATCACCATGTACAACGAGGATGACATTCTGTTCGCCCGC
ACCCTCATCGGTGTCTTCAAGAACATCGAGTACATGTGCAACCGGCCCAATAGCAAGACGTGGGGAAACGAGGCC
TGGAAGAAGATTGTCGTCTGCGTCGTCAGCGATGGTCGCGCCAAGATCAACCCGCGCACCAAAGCTGTGCTCTCG
GGCATGGGCGTTTACCAGGAGGGCATCGCCAAGCAGCAGGTCAATAACAAGGACGTGACGGCCCACATCTACGAG
TATACGACGCAGACTCATCTACAGCTCAAGAACGACACCATCACCCTCGTGCACCGTCGCCGGCCCGTGCAGATG
ATCTTTTGCCTCAAGGAAAAGAACCAAAAGAAGATCAACTCGCACCGCTGGTTCTTCCAAGCCTTTGGCCGCGTC
CTCGACCCCAATATTTGCGTTCTGCTCGATGCCGGCACCCGGCCGGGTGGCAACTCCATCTATCACCTATGGAAG
GCCTTTGACCTCGAGCCCATGTGCGGCGGCGCCTGCGGTGAAATCAAGGCCATGTTAGGCACTGGCGGCAAGAAC
CTGCTTAACCCGCTAGTGGCGACGCAAAACTTTGAGTACAAGATGAGCAACATCCTCGATAAGCCCCTCGAATCG
GCCTTTGGCTTCATCTCCGTCCTGCCCGGGGCCTTTTCTGCCTACCGCTATGTCGCGTTGCAGAACGATAAGAAC
GGCAAGGGGCCACTCGAGAAGTACTTCTTGGGCGAGACGCTGCACGGCGGTAGCAACGCCGGCCTCTTCGAGTCC
AACATGTACCTGGCCGAGGACCGCATCCTGTGCTTCGAGCTCGTCACCAAGCGCAACTGCCACTGGATTCTGCAG
TACGTCAAGTCGGCCAACGGCGAGACGGACGTGCCGGACTCGGTCACGGAGCTGGTACTGCAACGACGCCGCTGG
CTGAACGGTTCCTTCTTCGCCGCCATCTACGCCATTGCCCACTTCCACGAGTTCTTCCGCTCAAACCATTCCATC
TTCCGCAAGCTCGGCTTCTTTATCGAGTTTGTCTTTCAAACGATCAACATGATTTTCGCCTGGTTTGCTATTGGC
AACTTCTTCCTCGTCTTCAAGATCTTGACCACGAGCTTGGGCTCCAACGATTTACTCGGTAGGGTCGGGGAAATT
CTGAGCGTCGTCTTCACCTGGCTCTACGGCGTCATTCTCATCACCTGCTTCGTCCTGTCCATGGGGAACCGTCCG
GCCGGCTCCGGCCGGTTGTATACGGCCATGGTTTGGTTCTGGGCCGGCATCATGATCTACCTCTTGTTCGCGGCC
ATCTTCATCGCCGTCAAGGCCATCATCGCCGACGTCAACGACGCCGACGGCTTCAACATCCGGCAGCTCTTTACC
AATCAGGTCTTTTACACGCTCATCGTGTCCGTCATGTCCACGTACGGCATCTGGCTACTGGCGTCTCTCATCATG
TTTGACCCGTGGCACATGATCACGTCGTTTGTGCAGTACATGCTACTGTCACCGACTTACACCAATGTTCTCAAC
GTCTACGCCTTTTGCAACACGCACGACGTGTCGTGGGGCACAAAAGGTGACGACACGGTTGAGAAGCTGCCGTCG
GTCAACACCAAGGACGGCCAGGGCAAGACGGACCTGCCTGACGAAGGGGACCTCAACGCACAGTACCAGCGCGAA
GTTGCCCTGTTCAGCGCCAAGTACAAGGCGGTCAAGACGAAGCCGACGGCGGCGCAGCTTCAGGAGAAGCAGTTG
GACTACTACCGCGGTGTGCGGACGGGCGTCGTTCTCATCTGGATGATTACGAACTTTGCGCTGGCCGCCTTAGTT
CTGAGCTCGGCCGGGTTGGAGAAGATTACACCGGGGCGGGGCAGTCAGGCGGACGAGGAGAAGGCTCGTGCGAAT
CTCTACATGGCCATCGTCCTGTGGAGCGTGGCGGTGCTGAGTGGCTTCAAGTTCTTGGGGGCCATGTGGTTCCTC
ATCGTGCGGCTTTTTAGGGGCGTC
Transcript >Ophio5|6003
ATGTCGTACGATCGCCTCGACAACGGCTACTACCACGACGCCATGGACTCCCGTCACGGACGTCCGTATCGGACA
CCGTCTCCCGGCCAGCCGCTGCAGCAGGGATACCAACTCGACGACAGCCCCTATGGCCAGCAGCGCCTCACTCCG
GGCCCACCAGGCCATCTTCAACGCCTGGGAACCCCAAGCGACCAATTGAATATAGTTGCTGCCCAAACCGTTGAA
AACCTTCCGTATTCGGGCTCCCGCCACCAACAGGGGTACGGGGACGCCGTCGTCAACCCTCAACTCATCCACGAC
GAGTACGGGGGCACGCATTCAAAGTATCCCTCACAGGACGGCGCCTACTTCGACCCCCCGACCCACGGCTACGAC
CTCGACGACCGCCGGCCCATGCTGGATCATCAGAGCTCGTCGGGCTACGAGGACCCATACCATGACCACCCACAG
CAGCGGCTGCAGCAGCAGGCCTCTGGGGCCCTGAGGCGCTGGAAGACGGTCAAGCAGGTGCTGCTCTACCGCGGC
AACCTGGTCCTCGACTGTCCCGTGCCGCCCGTTCTCCTGCAGCAAAACCAGCACGGCGAGCGCGACGAGTTCACC
CACATGCGGTACTCGGCCGCCACTTGCGACCCGTCCGAGTTTTACAACGAGAACTTTACCCTCCGGCAGAAGCTG
TTCAGCAAACCGCGCCATACCGAACTCTTCATCGTCATCACCATGTACAACGAGGATGACATTCTGTTCGCCCGC
ACCCTCATCGGTGTCTTCAAGAACATCGAGTACATGTGCAACCGGCCCAATAGCAAGACGTGGGGAAACGAGGCC
TGGAAGAAGATTGTCGTCTGCGTCGTCAGCGATGGTCGCGCCAAGATCAACCCGCGCACCAAAGCTGTGCTCTCG
GGCATGGGCGTTTACCAGGAGGGCATCGCCAAGCAGCAGGTCAATAACAAGGACGTGACGGCCCACATCTACGAG
TATACGACGCAGACTCATCTACAGCTCAAGAACGACACCATCACCCTCGTGCACCGTCGCCGGCCCGTGCAGATG
ATCTTTTGCCTCAAGGAAAAGAACCAAAAGAAGATCAACTCGCACCGCTGGTTCTTCCAAGCCTTTGGCCGCGTC
CTCGACCCCAATATTTGCGTTCTGCTCGATGCCGGCACCCGGCCGGGTGGCAACTCCATCTATCACCTATGGAAG
GCCTTTGACCTCGAGCCCATGTGCGGCGGCGCCTGCGGTGAAATCAAGGCCATGTTAGGCACTGGCGGCAAGAAC
CTGCTTAACCCGCTAGTGGCGACGCAAAACTTTGAGTACAAGATGAGCAACATCCTCGATAAGCCCCTCGAATCG
GCCTTTGGCTTCATCTCCGTCCTGCCCGGGGCCTTTTCTGCCTACCGCTATGTCGCGTTGCAGAACGATAAGAAC
GGCAAGGGGCCACTCGAGAAGTACTTCTTGGGCGAGACGCTGCACGGCGGTAGCAACGCCGGCCTCTTCGAGTCC
AACATGTACCTGGCCGAGGACCGCATCCTGTGCTTCGAGCTCGTCACCAAGCGCAACTGCCACTGGATTCTGCAG
TACGTCAAGTCGGCCAACGGCGAGACGGACGTGCCGGACTCGGTCACGGAGCTGGTACTGCAACGACGCCGCTGG
CTGAACGGTTCCTTCTTCGCCGCCATCTACGCCATTGCCCACTTCCACGAGTTCTTCCGCTCAAACCATTCCATC
TTCCGCAAGCTCGGCTTCTTTATCGAGTTTGTCTTTCAAACGATCAACATGATTTTCGCCTGGTTTGCTATTGGC
AACTTCTTCCTCGTCTTCAAGATCTTGACCACGAGCTTGGGCTCCAACGATTTACTCGGTAGGGTCGGGGAAATT
CTGAGCGTCGTCTTCACCTGGCTCTACGGCGTCATTCTCATCACCTGCTTCGTCCTGTCCATGGGGAACCGTCCG
GCCGGCTCCGGCCGGTTGTATACGGCCATGGTTTGGTTCTGGGCCGGCATCATGATCTACCTCTTGTTCGCGGCC
ATCTTCATCGCCGTCAAGGCCATCATCGCCGACGTCAACGACGCCGACGGCTTCAACATCCGGCAGCTCTTTACC
AATCAGGTCTTTTACACGCTCATCGTGTCCGTCATGTCCACGTACGGCATCTGGCTACTGGCGTCTCTCATCATG
TTTGACCCGTGGCACATGATCACGTCGTTTGTGCAGTACATGCTACTGTCACCGACTTACACCAATGTTCTCAAC
GTCTACGCCTTTTGCAACACGCACGACGTGTCGTGGGGCACAAAAGGTGACGACACGGTTGAGAAGCTGCCGTCG
GTCAACACCAAGGACGGCCAGGGCAAGACGGACCTGCCTGACGAAGGGGACCTCAACGCACAGTACCAGCGCGAA
GTTGCCCTGTTCAGCGCCAAGTACAAGGCGGTCAAGACGAAGCCGACGGCGGCGCAGCTTCAGGAGAAGCAGTTG
GACTACTACCGCGGTGTGCGGACGGGCGTCGTTCTCATCTGGATGATTACGAACTTTGCGCTGGCCGCCTTAGTT
CTGAGCTCGGCCGGGTTGGAGAAGATTACACCGGGGCGGGGCAGTCAGGCGGACGAGGAGAAGGCTCGTGCGAAT
CTCTACATGGCCATCGTCCTGTGGAGCGTGGCGGTGCTGAGTGGCTTCAAGTTCTTGGGGGCCATGTGGTTCCTC
ATCGTGCGGCTTTTTAGGGGCGTCTAG
Gene >Ophio5|6003
ATGTCGTACGATCGCCTCGGTACGTGGCCCGCTTGCGTTACGACTTTACGCCCCTCCCCGCCCCTTTGGACGCGA
TTTCTCTCTCCCTGATTCACCGGGCTGCCTTTTCCCATCCCTAGCCTCGTGGCCCTCGCGTGCCCCCTTTTGCCT
CTCCTTTGTTCTGTCATCATCTTTTTTTCCCGTCCCCTTTTAATCCACATCGACTGTTCAAGAGGCAGTGGCGGT
CGCGTCGACTCTTGCGAGTTGCCGAGAGCCTTAGTTTCTTCATCACTAACCTTTGCAGACAACGGCTACTACCAC
GACGCCATGGACTCCCGTCACGGACGTCCGTATCGGACACCGTCTCCCGGCCAGCCGCTGCAGCAGGGATACCAA
CTCGACGACAGCCCCTATGGCCAGCAGCGCCTCACTCCGGGCCCACCAGGCCATCTTCAACGCCTGGGAACCCCA
AGCGACCAATTGAATATAGTTGCTGCCGTACGTCTGGCCAATTCAACTTTGACGCGCCCAAGGCTGACCGGGTCG
CCATAGCAAACCGTTGAAAACCTTCCGTATTCGGGCTCCCGCCACCAACAGGGGTACGGGGACGCCGTCGTCAAC
CCTCAACTCATCCACGACGAGTACGGGGGCACGCATTCAAAGTATCCCTCACAGGACGGCGCCTACTTCGACCCC
CCGACCCACGGCTACGACCTCGACGACCGCCGGCCCATGCTGGATCATCAGAGCTCGTCGGGCTACGAGGACCCA
TACCATGACCACCCACAGCAGCGGCTGCAGCAGCAGGCCTCTGGGGCCCTGAGGCGCTGGAAGACGGTCAAGCAG
GTGCTGCTCTACCGCGGCAACCTGGTCCTCGACTGTCCCGTGCCGCCCGTTCTCCTGCAGCAAAACCAGCACGGC
GAGCGCGACGAGTTCACCCACATGCGGTACTCGGCCGCCACTTGCGACCCGTCCGAGTTTTACAACGAGAACTTT
ACCCTCCGGCAGAAGCTGTTCAGCAAACCGCGCCATACCGAACTCTTCATCGTCATCACCATGTACAACGAGGAT
GACATTCTGTTCGCCCGCACCCTCATCGGTGTCTTCAAGAACATCGAGTACATGTGCAACCGGCCCAATAGCAAG
ACGTGGGGAAACGAGGCCTGGAAGAAGATTGTCGTCTGCGTCGTCAGCGATGGTCGCGCCAAGATCAACCCGCGC
ACCAAAGCTGTGCTCTCGGGCATGGGCGTTTACCAGGAGGGCATCGCCAAGCAGCAGGTCAATAACAAGGACGTG
ACGGCCCACATCTACGAGTATACGACGCAGACTCATCTACAGCTCAAGAACGACACCATCACCCTCGTGCACCGT
CGCCGGCCCGTGCAGATGATCTTTTGCCTCAAGGAAAAGAACCAAAAGAAGATCAACTCGCACCGCTGGTTCTTC
CAAGCCTTTGGCCGCGTCCTCGACCCCAATATTTGCGTTCTGCTCGATGCCGGCACCCGGCCGGGTGGCAACTCC
ATCTATCACCTATGGAAGGCCTTTGACCTCGAGCCCATGTGCGGCGGCGCCTGCGGTGAAATCAAGGCCATGTTA
GGCACTGGCGGCAAGAACCTGCTTAACCCGCTAGTGGCGACGCAAAACTTTGAGTACAAGATGAGCAACATCCTC
GATAAGCCCCTCGAATCGGCCTTTGGCTTCATCTCCGTCCTGCCCGGGGCCTTTTCTGCCTACCGCTATGTCGCG
TTGCAGAACGATAAGAACGGCAAGGGGCCACTCGAGAAGTACTTCTTGGGCGAGACGCTGCACGGCGGTAGCAAC
GCCGGCCTCTTCGAGTCCAACATGTACCTGGCCGAGGACCGCATCCTGTGCTTCGAGCTCGTCACCAAGCGCAAC
TGCCACTGGATTCTGCAGTACGTCAAGTCGGCCAACGGCGAGACGGACGTGCCGGACTCGGTCACGGAGCTGGTA
CTGCAACGACGCCGCTGGCTGAACGGTTCCTTCTTCGCCGCCATCTACGCCATTGCCCACTTCCACGAGTTCTTC
CGCTCAAACCATTCCATCTTCCGCAAGCTCGGCTTCTTTATCGAGTTTGTCTTTCAAACGATCAACATGATTTTC
GCCTGGTTTGCTATTGGCAACTTCTTCCTCGTCTTCAAGATCTTGACCACGAGCTTGGGCTCCAACGATTTACTC
GGTAGGGTCGGGGAAATTCTGAGCGTCGTCTTCACCTGGCTCTACGGCGTCATTCTCATCACCTGCTTCGTCCTG
TCCATGGGGAACCGTCCGGCCGGCTCCGGCCGGTTGTATACGGCCATGGTTTGGTTCTGGGCCGGCATCATGATG
TGAGCCCTCAATCCCGCGCCCTGCTCAGAACATGACTGACCGCAGCAGCTACCTCTTGTTCGCGGCCATCTTCAT
CGCCGTCAAGGCCATCATCGCCGACGTCAACGACGCCGACGGCTTCAACATCCGGCAGCTCTTTACCAATCAGGT
CTTTTACACGCTCATCGTGTCCGTCATGTCCACGTACGGCATCTGGCTACTGGCGTCTCTCATCATGTTTGACCC
GTGGCACATGATCACGTCGTTTGTGCAGTACATGCTACTGTCACCGACTTACACCAATGTTCTCAACGTCTACGC
CTTTTGCAACACGCACGACGTGTCGTGGGGCACAAAAGGTGACGACACGGTTGAGAAGCTGCCGTCGGTCAACAC
CAAGGACGGCCAGGGCAAGACGGACCTGCCTGACGAAGGGGACCTCAACGCACAGTACCAGCGCGAAGTTGCCCT
GTTCAGCGCCAAGTACAAGGCGGTCAAGACGAAGCCGACGGCGGCGCAGCTTCAGGAGAAGCAGTTGGACTACTA
CCGCGGTGTGCGGACGGGCGTCGTTCTCATCTGGATGATTACGAACTTTGCGCTGGCCGCCTTAGTTCTGAGCTC
GGCCGGGTTGGAGAAGATTACACCGGGGCGGGGCAGTCAGGCGGACGAGGAGAAGGCTCGTGCGAATCTCTACAT
GGCCATCGTCCTGTGGAGCGTGGCGGTGCTGAGTGGCTTCAAGTTCTTGGGGGCCATGTGGTTCCTCATCGTGCG
GCTTTTTAGGGGCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail