© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophio5|600 |
| Gene name | |
| Location | scaffold_116:12077..12814 |
| Strand | + |
| Gene length (bp) | 737 |
| Transcript length (bp) | 609 |
| Coding sequence length (bp) | 606 |
| Protein length (aa) | 202 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01849 | NAC | NAC domain | 9.0E-22 | 50 | 105 |
| PF19026 | HYPK_UBA | HYPK UBA domain | 6.9E-11 | 164 | 200 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4I2J8|NACA_GIBZE | Nascent polypeptide-associated complex subunit alpha OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD2 PE=3 SV=1 | 1 | 202 | 8.0E-90 |
| sp|Q7SI17|NACA_NEUCR | Nascent polypeptide-associated complex subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-1 PE=3 SV=1 | 1 | 202 | 4.0E-83 |
| sp|Q2H4Z2|NACA_CHAGB | Nascent polypeptide-associated complex subunit alpha OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD2 PE=3 SV=2 | 1 | 202 | 7.0E-80 |
| sp|A4RC89|NACA_MAGO7 | Nascent polypeptide-associated complex subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD2 PE=3 SV=1 | 1 | 202 | 6.0E-79 |
| sp|A7EIZ1|NACA_SCLS1 | Nascent polypeptide-associated complex subunit alpha OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd2 PE=3 SV=1 | 1 | 202 | 1.0E-70 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4I2J8|NACA_GIBZE | Nascent polypeptide-associated complex subunit alpha OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD2 PE=3 SV=1 | 1 | 202 | 8.0E-90 |
| sp|Q7SI17|NACA_NEUCR | Nascent polypeptide-associated complex subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-1 PE=3 SV=1 | 1 | 202 | 4.0E-83 |
| sp|Q2H4Z2|NACA_CHAGB | Nascent polypeptide-associated complex subunit alpha OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD2 PE=3 SV=2 | 1 | 202 | 7.0E-80 |
| sp|A4RC89|NACA_MAGO7 | Nascent polypeptide-associated complex subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD2 PE=3 SV=1 | 1 | 202 | 6.0E-79 |
| sp|A7EIZ1|NACA_SCLS1 | Nascent polypeptide-associated complex subunit alpha OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd2 PE=3 SV=1 | 1 | 202 | 1.0E-70 |
| sp|A6R641|NACA_AJECN | Nascent polypeptide-associated complex subunit alpha OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=EGD2 PE=3 SV=2 | 1 | 202 | 1.0E-68 |
| sp|Q1DHR3|NACA_COCIM | Nascent polypeptide-associated complex subunit alpha OS=Coccidioides immitis (strain RS) GN=EGD2 PE=3 SV=1 | 1 | 202 | 5.0E-67 |
| sp|A6SB28|NACA_BOTFB | Nascent polypeptide-associated complex subunit alpha OS=Botryotinia fuckeliana (strain B05.10) GN=egd2 PE=3 SV=1 | 1 | 202 | 3.0E-66 |
| sp|Q5AYK0|NACA_EMENI | Nascent polypeptide-associated complex subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=egd2 PE=3 SV=1 | 1 | 202 | 7.0E-66 |
| sp|P0C2C7|NACA_ASPTN | Nascent polypeptide-associated complex subunit alpha OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd2 PE=3 SV=1 | 1 | 202 | 1.0E-65 |
| sp|A2R4V1|NACA_ASPNC | Nascent polypeptide-associated complex subunit alpha OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=egd2 PE=3 SV=1 | 1 | 202 | 1.0E-65 |
| sp|Q2U955|NACA_ASPOR | Nascent polypeptide-associated complex subunit alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=egd2 PE=3 SV=1 | 1 | 202 | 6.0E-63 |
| sp|A1DLM0|NACA_NEOFI | Nascent polypeptide-associated complex subunit alpha OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=egd2 PE=3 SV=1 | 1 | 202 | 4.0E-60 |
| sp|Q4WD81|NACA_ASPFU | Nascent polypeptide-associated complex subunit alpha OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=egd2 PE=3 SV=1 | 1 | 202 | 4.0E-60 |
| sp|A1CMF8|NACA_ASPCL | Nascent polypeptide-associated complex subunit alpha OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=egd2 PE=3 SV=1 | 1 | 202 | 1.0E-59 |
| sp|Q0UKB5|NACA_PHANO | Nascent polypeptide-associated complex subunit alpha OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=EGD2 PE=3 SV=1 | 1 | 202 | 2.0E-59 |
| sp|Q8AWF2|NACA_ORENI | Nascent polypeptide-associated complex subunit alpha OS=Oreochromis niloticus GN=naca PE=2 SV=1 | 46 | 202 | 1.0E-46 |
| sp|Q60817|NACA_MOUSE | Nascent polypeptide-associated complex subunit alpha OS=Mus musculus GN=Naca PE=1 SV=1 | 46 | 202 | 3.0E-46 |
| sp|Q13765|NACA_HUMAN | Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens GN=NACA PE=1 SV=1 | 46 | 202 | 3.0E-46 |
| sp|Q5E9A1|NACA_BOVIN | Nascent polypeptide-associated complex subunit alpha OS=Bos taurus GN=NACA PE=1 SV=1 | 46 | 202 | 4.0E-46 |
| sp|Q68F90|NACA_XENTR | Nascent polypeptide-associated complex subunit alpha OS=Xenopus tropicalis GN=naca PE=2 SV=1 | 46 | 202 | 6.0E-46 |
| sp|Q6IP73|NACA_XENLA | Nascent polypeptide-associated complex subunit alpha OS=Xenopus laevis GN=naca PE=2 SV=1 | 46 | 202 | 6.0E-46 |
| sp|Q8JIU7|NACA_DANRE | Nascent polypeptide-associated complex subunit alpha OS=Danio rerio GN=naca PE=1 SV=1 | 46 | 202 | 3.0E-45 |
| sp|Q6QN10|NACA_CHILA | Nascent polypeptide-associated complex subunit alpha OS=Chinchilla lanigera PE=2 SV=1 | 46 | 202 | 8.0E-45 |
| sp|E9PAV3|NACAM_HUMAN | Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens GN=NACA PE=1 SV=1 | 46 | 202 | 1.0E-44 |
| sp|P70670|NACAM_MOUSE | Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus GN=Naca PE=1 SV=2 | 46 | 202 | 2.0E-44 |
| sp|Q5R9I9|NACA_PONAB | Nascent polypeptide-associated complex subunit alpha OS=Pongo abelii GN=NACA PE=2 SV=1 | 46 | 202 | 2.0E-44 |
| sp|Q9M612|NACA_PINTA | Nascent polypeptide-associated complex subunit alpha-like protein OS=Pinus taeda PE=2 SV=1 | 46 | 201 | 7.0E-44 |
| sp|Q9BZK3|NACP1_HUMAN | Putative nascent polypeptide-associated complex subunit alpha-like protein OS=Homo sapiens GN=NACAP1 PE=5 SV=1 | 46 | 202 | 7.0E-44 |
| sp|Q94518|NACA_DROME | Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster GN=Nacalpha PE=1 SV=2 | 46 | 202 | 5.0E-43 |
| sp|P87147|NACA_SCHPO | Nascent polypeptide-associated complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=egd2 PE=1 SV=1 | 25 | 202 | 3.0E-42 |
| sp|Q9H009|NACA2_HUMAN | Nascent polypeptide-associated complex subunit alpha-2 OS=Homo sapiens GN=NACA2 PE=1 SV=1 | 17 | 202 | 3.0E-42 |
| sp|Q86S66|NACA_CAEEL | Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans GN=icd-2 PE=1 SV=1 | 15 | 202 | 8.0E-42 |
| sp|Q94JX9|NACA2_ARATH | Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana GN=At3g49470 PE=2 SV=2 | 46 | 201 | 3.0E-41 |
| sp|Q61UX1|NACA_CAEBR | Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis briggsae GN=icd-2 PE=3 SV=1 | 46 | 202 | 2.0E-39 |
| sp|O15069|NACAD_HUMAN | NAC-alpha domain-containing protein 1 OS=Homo sapiens GN=NACAD PE=1 SV=3 | 46 | 202 | 9.0E-39 |
| sp|Q9SZY1|NACA4_ARATH | Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana GN=At4g10480 PE=1 SV=1 | 46 | 201 | 2.0E-38 |
| sp|Q9LHG9|NACA1_ARATH | Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana GN=At3g12390 PE=1 SV=1 | 46 | 201 | 4.0E-38 |
| sp|Q5SWP3|NACAD_MOUSE | NAC-alpha domain-containing protein 1 OS=Mus musculus GN=Nacad PE=1 SV=1 | 21 | 202 | 2.0E-36 |
| sp|Q8LGC6|NACA5_ARATH | Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana GN=At1g33040 PE=2 SV=2 | 46 | 201 | 8.0E-36 |
| sp|Q6BSN9|NACA_DEBHA | Nascent polypeptide-associated complex subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EGD2 PE=3 SV=1 | 37 | 201 | 8.0E-35 |
| sp|Q6ICZ8|NACA3_ARATH | Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana GN=At5g13850 PE=1 SV=1 | 46 | 201 | 8.0E-35 |
| sp|Q4P341|NACA_USTMA | Nascent polypeptide-associated complex subunit alpha OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EGD2 PE=3 SV=1 | 6 | 198 | 8.0E-33 |
| sp|Q756T5|NACA_ASHGO | Nascent polypeptide-associated complex subunit alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EGD2 PE=3 SV=1 | 37 | 201 | 1.0E-32 |
| sp|A7TG43|NACA_VANPO | Nascent polypeptide-associated complex subunit alpha OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=EGD2 PE=3 SV=1 | 37 | 201 | 3.0E-32 |
| sp|A3GHD3|NACA_PICST | Nascent polypeptide-associated complex subunit alpha OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=EGD2 PE=3 SV=1 | 37 | 201 | 6.0E-32 |
| sp|Q45FF9|NACA_BABDI | Nascent polypeptide-associated complex subunit alpha OS=Babesia divergens PE=2 SV=1 | 21 | 201 | 1.0E-31 |
| sp|P0CP07|NACA_CRYNB | Nascent polypeptide-associated complex subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EGD2 PE=3 SV=1 | 37 | 200 | 1.0E-31 |
| sp|P0CP06|NACA_CRYNJ | Nascent polypeptide-associated complex subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EGD2 PE=3 SV=1 | 37 | 200 | 1.0E-31 |
| sp|A5DXK7|NACA_LODEL | Nascent polypeptide-associated complex subunit alpha OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=EGD2 PE=3 SV=1 | 37 | 201 | 2.0E-29 |
| sp|A5DGN9|NACA_PICGU | Nascent polypeptide-associated complex subunit alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EGD2 PE=3 SV=2 | 37 | 201 | 2.0E-29 |
| sp|Q6FJD5|NACA_CANGA | Nascent polypeptide-associated complex subunit alpha OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EGD2 PE=3 SV=1 | 37 | 201 | 2.0E-29 |
| sp|Q6CDH0|NACA_YARLI | Nascent polypeptide-associated complex subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EGD2 PE=3 SV=1 | 41 | 201 | 4.0E-28 |
| sp|Q6CWG6|NACA_KLULA | Nascent polypeptide-associated complex subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EGD2 PE=3 SV=1 | 41 | 201 | 5.0E-28 |
| sp|Q5ANP2|NACA_CANAL | Nascent polypeptide-associated complex subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EGD2 PE=3 SV=1 | 37 | 201 | 2.0E-26 |
| sp|P38879|NACA_YEAST | Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EGD2 PE=1 SV=3 | 37 | 201 | 1.0E-21 |
| sp|A6ZT99|NACA_YEAS7 | Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain YJM789) GN=EGD2 PE=3 SV=1 | 37 | 201 | 1.0E-21 |
| sp|Q54U07|NACA_DICDI | Nascent polypeptide-associated complex subunit alpha OS=Dictyostelium discoideum GN=nacA PE=3 SV=1 | 47 | 201 | 3.0E-20 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 39 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| SC16a | Pure fungal culture | 500.62 | 253.46 | 747.78 |
| CcL | In ants, during behavior modification | 791.97 | 357.72 | 1226.22 |
| CcD | In ants, recently dead | 949.66 | 433.64 | 1465.68 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| SC16a | CcL | 0.071876 | no |
| SC16a | CcD | 0.010753 | yes |
| CcL | CcD | 0.535285 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophio5|600 MANPRVEELPDDPVQKPTVEDQDDSSDDSDAEEGGNLPAGSTAVIHSRNEKKARKALEKLHLTRITGITRVTLRR PKNILFVINQPEVYKSPNSNTYIVFGEAKIEDVNATAQQAAAQQLAAAGAEGDHAGHNHGESSKAAEATEAKKED DDDDGEEVDAEGLEDKDIELVMTQANVSRKKAVKALKENDNDIVNSIMALSI |
| Coding | >Ophio5|600 ATGGCGAACCCAAGAGTTGAGGAGCTTCCGGACGACCCTGTCCAGAAGCCCACAGTCGAGGATCAGGATGACAGC AGTGATGACTCCGATGCTGAGGAGGGCGGCAACTTGCCCGCCGGGTCGACGGCTGTGATCCATTCTCGCAACGAG AAGAAGGCCCGCAAGGCCCTGGAGAAACTGCATCTCACTCGGATCACGGGCATTACGCGTGTTACCCTTCGTCGG CCCAAGAACATCCTGTTCGTCATCAACCAGCCCGAGGTCTACAAATCTCCGAACAGCAACACCTACATTGTCTTT GGTGAGGCCAAGATCGAGGACGTCAACGCGACTGCTCAGCAGGCTGCCGCCCAACAACTTGCCGCTGCCGGTGCC GAAGGCGACCACGCTGGTCACAACCACGGAGAGTCCAGCAAGGCCGCCGAGGCGACGGAAGCCAAGAAGGAAGAC GACGATGACGACGGTGAGGAGGTCGACGCTGAAGGTCTCGAGGATAAGGACATCGAGCTGGTCATGACCCAAGCC AATGTCAGCCGCAAAAAGGCTGTGAAGGCGCTGAAGGAGAATGACAACGACATTGTCAACTCCATCATGGCCTTG AGCATC |
| Transcript | >Ophio5|600 ATGGCGAACCCAAGAGTTGAGGAGCTTCCGGACGACCCTGTCCAGAAGCCCACAGTCGAGGATCAGGATGACAGC AGTGATGACTCCGATGCTGAGGAGGGCGGCAACTTGCCCGCCGGGTCGACGGCTGTGATCCATTCTCGCAACGAG AAGAAGGCCCGCAAGGCCCTGGAGAAACTGCATCTCACTCGGATCACGGGCATTACGCGTGTTACCCTTCGTCGG CCCAAGAACATCCTGTTCGTCATCAACCAGCCCGAGGTCTACAAATCTCCGAACAGCAACACCTACATTGTCTTT GGTGAGGCCAAGATCGAGGACGTCAACGCGACTGCTCAGCAGGCTGCCGCCCAACAACTTGCCGCTGCCGGTGCC GAAGGCGACCACGCTGGTCACAACCACGGAGAGTCCAGCAAGGCCGCCGAGGCGACGGAAGCCAAGAAGGAAGAC GACGATGACGACGGTGAGGAGGTCGACGCTGAAGGTCTCGAGGATAAGGACATCGAGCTGGTCATGACCCAAGCC AATGTCAGCCGCAAAAAGGCTGTGAAGGCGCTGAAGGAGAATGACAACGACATTGTCAACTCCATCATGGCCTTG AGCATCTAG |
| Gene | >Ophio5|600 ATGGCGAACCCAAGAGTTGAGGAGCTTCCGGACGACCCTGTCCAGAAGCCCACAGTCGAGGATCAGGATGACAGC AGTGATGACTCCGATGCTGAGGAGGGCGGCAACTTGCCCGCCGGGTCGACGGCTGTGATCCATTCTCGCAACGAG AAGAAGGCCCGCAAGGCCCTGGAGAAACTGCATCTCACTCGGATCACGGGCATTACGCGTGTTACCCTTCGTCGG CCCAAGAACGTACGCATCCCTCGCGGCGACGCTTCTCTGTGTTGATGGACGACGCTTTGCTGACAAGACGCCCTA AACAGATCCTGTTCGTCATCAACCAGCCCGAGGTCTACAAATCTCCGAACAGCAACACCTACATGTTCGTTTTTC TCATACCCTTACCAAGTCTCAGCATCGTCTGACAATTTGACTCTAGTGTCTTTGGTGAGGCCAAGATCGAGGACG TCAACGCGACTGCTCAGCAGGCTGCCGCCCAACAACTTGCCGCTGCCGGTGCCGAAGGCGACCACGCTGGTCACA ACCACGGAGAGTCCAGCAAGGCCGCCGAGGCGACGGAAGCCAAGAAGGAAGACGACGATGACGACGGTGAGGAGG TCGACGCTGAAGGTCTCGAGGATAAGGACATCGAGCTGGTCATGACCCAAGCCAATGTCAGCCGCAAAAAGGCTG TGAAGGCGCTGAAGGAGAATGACAACGACATTGTCAACTCCATCATGGCCTTGAGCATCTAG |