Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|600
Gene name
Locationscaffold_116:12077..12814
Strand+
Gene length (bp)737
Transcript length (bp)609
Coding sequence length (bp)606
Protein length (aa) 202

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01849 NAC NAC domain 9.0E-22 50 105
PF19026 HYPK_UBA HYPK UBA domain 6.9E-11 164 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2J8|NACA_GIBZE Nascent polypeptide-associated complex subunit alpha OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD2 PE=3 SV=1 1 202 8.0E-90
sp|Q7SI17|NACA_NEUCR Nascent polypeptide-associated complex subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-1 PE=3 SV=1 1 202 4.0E-83
sp|Q2H4Z2|NACA_CHAGB Nascent polypeptide-associated complex subunit alpha OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD2 PE=3 SV=2 1 202 7.0E-80
sp|A4RC89|NACA_MAGO7 Nascent polypeptide-associated complex subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD2 PE=3 SV=1 1 202 6.0E-79
sp|A7EIZ1|NACA_SCLS1 Nascent polypeptide-associated complex subunit alpha OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd2 PE=3 SV=1 1 202 1.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2J8|NACA_GIBZE Nascent polypeptide-associated complex subunit alpha OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD2 PE=3 SV=1 1 202 8.0E-90
sp|Q7SI17|NACA_NEUCR Nascent polypeptide-associated complex subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-1 PE=3 SV=1 1 202 4.0E-83
sp|Q2H4Z2|NACA_CHAGB Nascent polypeptide-associated complex subunit alpha OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD2 PE=3 SV=2 1 202 7.0E-80
sp|A4RC89|NACA_MAGO7 Nascent polypeptide-associated complex subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD2 PE=3 SV=1 1 202 6.0E-79
sp|A7EIZ1|NACA_SCLS1 Nascent polypeptide-associated complex subunit alpha OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd2 PE=3 SV=1 1 202 1.0E-70
sp|A6R641|NACA_AJECN Nascent polypeptide-associated complex subunit alpha OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=EGD2 PE=3 SV=2 1 202 1.0E-68
sp|Q1DHR3|NACA_COCIM Nascent polypeptide-associated complex subunit alpha OS=Coccidioides immitis (strain RS) GN=EGD2 PE=3 SV=1 1 202 5.0E-67
sp|A6SB28|NACA_BOTFB Nascent polypeptide-associated complex subunit alpha OS=Botryotinia fuckeliana (strain B05.10) GN=egd2 PE=3 SV=1 1 202 3.0E-66
sp|Q5AYK0|NACA_EMENI Nascent polypeptide-associated complex subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=egd2 PE=3 SV=1 1 202 7.0E-66
sp|P0C2C7|NACA_ASPTN Nascent polypeptide-associated complex subunit alpha OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd2 PE=3 SV=1 1 202 1.0E-65
sp|A2R4V1|NACA_ASPNC Nascent polypeptide-associated complex subunit alpha OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=egd2 PE=3 SV=1 1 202 1.0E-65
sp|Q2U955|NACA_ASPOR Nascent polypeptide-associated complex subunit alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=egd2 PE=3 SV=1 1 202 6.0E-63
sp|A1DLM0|NACA_NEOFI Nascent polypeptide-associated complex subunit alpha OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=egd2 PE=3 SV=1 1 202 4.0E-60
sp|Q4WD81|NACA_ASPFU Nascent polypeptide-associated complex subunit alpha OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=egd2 PE=3 SV=1 1 202 4.0E-60
sp|A1CMF8|NACA_ASPCL Nascent polypeptide-associated complex subunit alpha OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=egd2 PE=3 SV=1 1 202 1.0E-59
sp|Q0UKB5|NACA_PHANO Nascent polypeptide-associated complex subunit alpha OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=EGD2 PE=3 SV=1 1 202 2.0E-59
sp|Q8AWF2|NACA_ORENI Nascent polypeptide-associated complex subunit alpha OS=Oreochromis niloticus GN=naca PE=2 SV=1 46 202 1.0E-46
sp|Q60817|NACA_MOUSE Nascent polypeptide-associated complex subunit alpha OS=Mus musculus GN=Naca PE=1 SV=1 46 202 3.0E-46
sp|Q13765|NACA_HUMAN Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens GN=NACA PE=1 SV=1 46 202 3.0E-46
sp|Q5E9A1|NACA_BOVIN Nascent polypeptide-associated complex subunit alpha OS=Bos taurus GN=NACA PE=1 SV=1 46 202 4.0E-46
sp|Q68F90|NACA_XENTR Nascent polypeptide-associated complex subunit alpha OS=Xenopus tropicalis GN=naca PE=2 SV=1 46 202 6.0E-46
sp|Q6IP73|NACA_XENLA Nascent polypeptide-associated complex subunit alpha OS=Xenopus laevis GN=naca PE=2 SV=1 46 202 6.0E-46
sp|Q8JIU7|NACA_DANRE Nascent polypeptide-associated complex subunit alpha OS=Danio rerio GN=naca PE=1 SV=1 46 202 3.0E-45
sp|Q6QN10|NACA_CHILA Nascent polypeptide-associated complex subunit alpha OS=Chinchilla lanigera PE=2 SV=1 46 202 8.0E-45
sp|E9PAV3|NACAM_HUMAN Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens GN=NACA PE=1 SV=1 46 202 1.0E-44
sp|P70670|NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus GN=Naca PE=1 SV=2 46 202 2.0E-44
sp|Q5R9I9|NACA_PONAB Nascent polypeptide-associated complex subunit alpha OS=Pongo abelii GN=NACA PE=2 SV=1 46 202 2.0E-44
sp|Q9M612|NACA_PINTA Nascent polypeptide-associated complex subunit alpha-like protein OS=Pinus taeda PE=2 SV=1 46 201 7.0E-44
sp|Q9BZK3|NACP1_HUMAN Putative nascent polypeptide-associated complex subunit alpha-like protein OS=Homo sapiens GN=NACAP1 PE=5 SV=1 46 202 7.0E-44
sp|Q94518|NACA_DROME Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster GN=Nacalpha PE=1 SV=2 46 202 5.0E-43
sp|P87147|NACA_SCHPO Nascent polypeptide-associated complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=egd2 PE=1 SV=1 25 202 3.0E-42
sp|Q9H009|NACA2_HUMAN Nascent polypeptide-associated complex subunit alpha-2 OS=Homo sapiens GN=NACA2 PE=1 SV=1 17 202 3.0E-42
sp|Q86S66|NACA_CAEEL Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans GN=icd-2 PE=1 SV=1 15 202 8.0E-42
sp|Q94JX9|NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana GN=At3g49470 PE=2 SV=2 46 201 3.0E-41
sp|Q61UX1|NACA_CAEBR Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis briggsae GN=icd-2 PE=3 SV=1 46 202 2.0E-39
sp|O15069|NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens GN=NACAD PE=1 SV=3 46 202 9.0E-39
sp|Q9SZY1|NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana GN=At4g10480 PE=1 SV=1 46 201 2.0E-38
sp|Q9LHG9|NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana GN=At3g12390 PE=1 SV=1 46 201 4.0E-38
sp|Q5SWP3|NACAD_MOUSE NAC-alpha domain-containing protein 1 OS=Mus musculus GN=Nacad PE=1 SV=1 21 202 2.0E-36
sp|Q8LGC6|NACA5_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana GN=At1g33040 PE=2 SV=2 46 201 8.0E-36
sp|Q6BSN9|NACA_DEBHA Nascent polypeptide-associated complex subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EGD2 PE=3 SV=1 37 201 8.0E-35
sp|Q6ICZ8|NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana GN=At5g13850 PE=1 SV=1 46 201 8.0E-35
sp|Q4P341|NACA_USTMA Nascent polypeptide-associated complex subunit alpha OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EGD2 PE=3 SV=1 6 198 8.0E-33
sp|Q756T5|NACA_ASHGO Nascent polypeptide-associated complex subunit alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EGD2 PE=3 SV=1 37 201 1.0E-32
sp|A7TG43|NACA_VANPO Nascent polypeptide-associated complex subunit alpha OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=EGD2 PE=3 SV=1 37 201 3.0E-32
sp|A3GHD3|NACA_PICST Nascent polypeptide-associated complex subunit alpha OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=EGD2 PE=3 SV=1 37 201 6.0E-32
sp|Q45FF9|NACA_BABDI Nascent polypeptide-associated complex subunit alpha OS=Babesia divergens PE=2 SV=1 21 201 1.0E-31
sp|P0CP07|NACA_CRYNB Nascent polypeptide-associated complex subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EGD2 PE=3 SV=1 37 200 1.0E-31
sp|P0CP06|NACA_CRYNJ Nascent polypeptide-associated complex subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EGD2 PE=3 SV=1 37 200 1.0E-31
sp|A5DXK7|NACA_LODEL Nascent polypeptide-associated complex subunit alpha OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=EGD2 PE=3 SV=1 37 201 2.0E-29
sp|A5DGN9|NACA_PICGU Nascent polypeptide-associated complex subunit alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EGD2 PE=3 SV=2 37 201 2.0E-29
sp|Q6FJD5|NACA_CANGA Nascent polypeptide-associated complex subunit alpha OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EGD2 PE=3 SV=1 37 201 2.0E-29
sp|Q6CDH0|NACA_YARLI Nascent polypeptide-associated complex subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EGD2 PE=3 SV=1 41 201 4.0E-28
sp|Q6CWG6|NACA_KLULA Nascent polypeptide-associated complex subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EGD2 PE=3 SV=1 41 201 5.0E-28
sp|Q5ANP2|NACA_CANAL Nascent polypeptide-associated complex subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EGD2 PE=3 SV=1 37 201 2.0E-26
sp|P38879|NACA_YEAST Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EGD2 PE=1 SV=3 37 201 1.0E-21
sp|A6ZT99|NACA_YEAS7 Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain YJM789) GN=EGD2 PE=3 SV=1 37 201 1.0E-21
sp|Q54U07|NACA_DICDI Nascent polypeptide-associated complex subunit alpha OS=Dictyostelium discoideum GN=nacA PE=3 SV=1 47 201 3.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|600
MANPRVEELPDDPVQKPTVEDQDDSSDDSDAEEGGNLPAGSTAVIHSRNEKKARKALEKLHLTRITGITRVTLRR
PKNILFVINQPEVYKSPNSNTYIVFGEAKIEDVNATAQQAAAQQLAAAGAEGDHAGHNHGESSKAAEATEAKKED
DDDDGEEVDAEGLEDKDIELVMTQANVSRKKAVKALKENDNDIVNSIMALSI
Coding >Ophio5|600
ATGGCGAACCCAAGAGTTGAGGAGCTTCCGGACGACCCTGTCCAGAAGCCCACAGTCGAGGATCAGGATGACAGC
AGTGATGACTCCGATGCTGAGGAGGGCGGCAACTTGCCCGCCGGGTCGACGGCTGTGATCCATTCTCGCAACGAG
AAGAAGGCCCGCAAGGCCCTGGAGAAACTGCATCTCACTCGGATCACGGGCATTACGCGTGTTACCCTTCGTCGG
CCCAAGAACATCCTGTTCGTCATCAACCAGCCCGAGGTCTACAAATCTCCGAACAGCAACACCTACATTGTCTTT
GGTGAGGCCAAGATCGAGGACGTCAACGCGACTGCTCAGCAGGCTGCCGCCCAACAACTTGCCGCTGCCGGTGCC
GAAGGCGACCACGCTGGTCACAACCACGGAGAGTCCAGCAAGGCCGCCGAGGCGACGGAAGCCAAGAAGGAAGAC
GACGATGACGACGGTGAGGAGGTCGACGCTGAAGGTCTCGAGGATAAGGACATCGAGCTGGTCATGACCCAAGCC
AATGTCAGCCGCAAAAAGGCTGTGAAGGCGCTGAAGGAGAATGACAACGACATTGTCAACTCCATCATGGCCTTG
AGCATC
Transcript >Ophio5|600
ATGGCGAACCCAAGAGTTGAGGAGCTTCCGGACGACCCTGTCCAGAAGCCCACAGTCGAGGATCAGGATGACAGC
AGTGATGACTCCGATGCTGAGGAGGGCGGCAACTTGCCCGCCGGGTCGACGGCTGTGATCCATTCTCGCAACGAG
AAGAAGGCCCGCAAGGCCCTGGAGAAACTGCATCTCACTCGGATCACGGGCATTACGCGTGTTACCCTTCGTCGG
CCCAAGAACATCCTGTTCGTCATCAACCAGCCCGAGGTCTACAAATCTCCGAACAGCAACACCTACATTGTCTTT
GGTGAGGCCAAGATCGAGGACGTCAACGCGACTGCTCAGCAGGCTGCCGCCCAACAACTTGCCGCTGCCGGTGCC
GAAGGCGACCACGCTGGTCACAACCACGGAGAGTCCAGCAAGGCCGCCGAGGCGACGGAAGCCAAGAAGGAAGAC
GACGATGACGACGGTGAGGAGGTCGACGCTGAAGGTCTCGAGGATAAGGACATCGAGCTGGTCATGACCCAAGCC
AATGTCAGCCGCAAAAAGGCTGTGAAGGCGCTGAAGGAGAATGACAACGACATTGTCAACTCCATCATGGCCTTG
AGCATCTAG
Gene >Ophio5|600
ATGGCGAACCCAAGAGTTGAGGAGCTTCCGGACGACCCTGTCCAGAAGCCCACAGTCGAGGATCAGGATGACAGC
AGTGATGACTCCGATGCTGAGGAGGGCGGCAACTTGCCCGCCGGGTCGACGGCTGTGATCCATTCTCGCAACGAG
AAGAAGGCCCGCAAGGCCCTGGAGAAACTGCATCTCACTCGGATCACGGGCATTACGCGTGTTACCCTTCGTCGG
CCCAAGAACGTACGCATCCCTCGCGGCGACGCTTCTCTGTGTTGATGGACGACGCTTTGCTGACAAGACGCCCTA
AACAGATCCTGTTCGTCATCAACCAGCCCGAGGTCTACAAATCTCCGAACAGCAACACCTACATGTTCGTTTTTC
TCATACCCTTACCAAGTCTCAGCATCGTCTGACAATTTGACTCTAGTGTCTTTGGTGAGGCCAAGATCGAGGACG
TCAACGCGACTGCTCAGCAGGCTGCCGCCCAACAACTTGCCGCTGCCGGTGCCGAAGGCGACCACGCTGGTCACA
ACCACGGAGAGTCCAGCAAGGCCGCCGAGGCGACGGAAGCCAAGAAGGAAGACGACGATGACGACGGTGAGGAGG
TCGACGCTGAAGGTCTCGAGGATAAGGACATCGAGCTGGTCATGACCCAAGCCAATGTCAGCCGCAAAAAGGCTG
TGAAGGCGCTGAAGGAGAATGACAACGACATTGTCAACTCCATCATGGCCTTGAGCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail