Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6
Gene name
Locationscaffold_1:9386..11722
Strand-
Gene length (bp)2336
Transcript length (bp)1893
Coding sequence length (bp)1890
Protein length (aa) 630

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09423 PhoD PhoD-like phosphatase 1.3E-109 202 553
PF16655 PhoD_N PhoD-like phosphatase, N-terminal domain 2.1E-27 67 189

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P42251|PPBD_BACSU Alkaline phosphatase D OS=Bacillus subtilis (strain 168) GN=phoD PE=1 SV=3 65 617 9.0E-75
sp|Q8KRU5|PLD_STRCW Phospholipase D OS=Streptomyces chromofuscus GN=pld PE=1 SV=2 65 554 5.0E-67

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6
MRLRAVQLLVANLVAITTTATKHGLDGNINYGSPSVRHQVLGIDVDAVSRRARKRSVTKPTNLHFTHGVASGDPF
PDSVIIWTRVAPSWSSDRSAAPVSGTEQLYSHDTDAFIKADPNPICVIWKVFQALSTPEANISIVAAKGMAWTTS
DIDYTVKVEARGLKPLTQYSYQFTICDTDKHSPVGRTKTAPGHDDDVSQLSFAVFSCSNYPVGYFNAYGNAARKN
KHDFVLHLGDYIYEYPDIGERATRPQDYLFTLHDYRTRHGQYRTDPDLQLLAQNYAWIPTWDDHEFANNGYRDGF
SGLNNSEDSFLQTGRQVTVDSRKVNAVRAYFEWMPIRQADPDDGLRVWRSFQMGKLLDLVILDTRNYDRSITSLD
WNDHYIDRIRNDPSRTLMGSRQERWFYRSLSESKSRGARWRIVGNQIVFSRVLDKTGAMSGDDWNGYLANRNRTL
QHLYGNQIDNTIFLAGDSHENWVSDLAWLGNVGYNRNTGKGAIGVEFAGTAVSSTGHHGPIEPRVGQRARGMIKR
NDEMQWQEGYYRGYFVLTVTPTEAKAEFYGTPSVATRNSWELPLANFTVVAGENHIERPVAGGKVESGAVRNGAV
RHSNYSLDTSTGEWRVIGFDRMYLRGEGDD
Coding >Ophio5|6
ATGCGGCTCCGAGCAGTCCAGCTCCTGGTAGCCAATCTGGTGGCGATAACGACGACGGCCACGAAACATGGCTTG
GACGGAAACATCAACTACGGCAGCCCATCCGTTCGGCATCAAGTGCTGGGCATCGACGTCGACGCCGTCTCGCGC
CGAGCCAGGAAGCGATCGGTAACGAAGCCTACGAACCTACACTTCACCCACGGCGTCGCCTCGGGCGATCCCTTC
CCGGATAGTGTCATCATCTGGACCCGAGTGGCGCCTTCGTGGTCGTCGGATCGGAGCGCGGCGCCCGTCAGTGGT
ACGGAGCAGCTTTATAGCCACGACACGGATGCCTTCATCAAGGCGGACCCGAACCCCATATGCGTCATATGGAAG
GTCTTTCAGGCCTTGAGTACGCCCGAGGCCAATATCAGCATCGTCGCCGCCAAGGGTATGGCTTGGACGACGTCG
GATATCGATTATACCGTCAAGGTCGAAGCTCGTGGGCTGAAGCCGCTCACGCAGTATAGCTATCAGTTTACCATT
TGCGACACCGACAAGCACAGCCCTGTCGGCCGGACCAAGACGGCGCCGGGACACGACGACGATGTGTCACAGCTC
AGTTTTGCCGTCTTTTCCTGCAGCAATTACCCGGTCGGCTACTTCAACGCCTACGGCAACGCGGCCCGCAAGAAT
AAACACGACTTCGTCCTACACCTGGGCGACTACATCTACGAATACCCCGACATCGGCGAGCGCGCAACCCGGCCA
CAGGACTACCTGTTCACGCTTCACGATTATCGGACACGCCACGGCCAGTACCGCACCGATCCGGACCTGCAACTG
CTTGCGCAGAATTACGCCTGGATACCCACATGGGATGACCACGAGTTTGCCAATAACGGATACCGCGATGGCTTC
AGCGGGCTCAACAACTCCGAGGACTCGTTCTTGCAAACGGGCCGGCAGGTTACTGTGGACAGTCGCAAGGTCAAC
GCGGTGCGGGCGTACTTTGAGTGGATGCCCATTCGACAGGCCGACCCGGACGACGGGCTTCGCGTCTGGCGCTCG
TTTCAGATGGGAAAGCTGCTGGACCTCGTCATCCTCGACACGCGCAATTATGACCGGAGCATCACCTCGCTCGAC
TGGAACGACCATTACATCGATCGCATCCGCAACGACCCCAGCCGTACGCTCATGGGGTCTCGCCAGGAGCGGTGG
TTCTATCGATCGTTGAGCGAGTCCAAGAGCCGCGGCGCGCGATGGCGCATCGTCGGCAATCAGATCGTCTTCTCA
CGCGTCTTGGATAAGACGGGCGCCATGTCCGGCGACGACTGGAACGGTTATCTGGCCAATCGCAACCGCACGTTG
CAGCACCTGTACGGCAACCAGATCGACAACACCATCTTTCTGGCCGGCGACAGCCACGAGAACTGGGTATCGGAC
CTTGCCTGGCTCGGTAACGTCGGCTACAACCGAAACACCGGCAAGGGCGCCATCGGCGTCGAGTTCGCCGGAACA
GCAGTCAGCTCGACAGGGCATCACGGACCGATCGAACCGCGAGTAGGCCAGCGAGCGCGCGGCATGATCAAGCGC
AACGACGAGATGCAATGGCAAGAGGGCTATTACCGCGGGTATTTCGTCCTGACGGTGACGCCGACGGAAGCCAAG
GCCGAGTTCTATGGCACGCCGTCGGTGGCGACACGCAACTCGTGGGAGCTTCCACTGGCCAATTTCACCGTCGTA
GCGGGTGAAAACCACATCGAGCGCCCCGTGGCCGGAGGAAAGGTCGAGTCCGGGGCGGTAAGGAATGGTGCGGTG
CGGCATAGTAATTACTCGCTCGACACGTCGACGGGCGAGTGGAGGGTCATTGGCTTCGACCGCATGTACCTGCGC
GGCGAGGGCGATGAT
Transcript >Ophio5|6
ATGCGGCTCCGAGCAGTCCAGCTCCTGGTAGCCAATCTGGTGGCGATAACGACGACGGCCACGAAACATGGCTTG
GACGGAAACATCAACTACGGCAGCCCATCCGTTCGGCATCAAGTGCTGGGCATCGACGTCGACGCCGTCTCGCGC
CGAGCCAGGAAGCGATCGGTAACGAAGCCTACGAACCTACACTTCACCCACGGCGTCGCCTCGGGCGATCCCTTC
CCGGATAGTGTCATCATCTGGACCCGAGTGGCGCCTTCGTGGTCGTCGGATCGGAGCGCGGCGCCCGTCAGTGGT
ACGGAGCAGCTTTATAGCCACGACACGGATGCCTTCATCAAGGCGGACCCGAACCCCATATGCGTCATATGGAAG
GTCTTTCAGGCCTTGAGTACGCCCGAGGCCAATATCAGCATCGTCGCCGCCAAGGGTATGGCTTGGACGACGTCG
GATATCGATTATACCGTCAAGGTCGAAGCTCGTGGGCTGAAGCCGCTCACGCAGTATAGCTATCAGTTTACCATT
TGCGACACCGACAAGCACAGCCCTGTCGGCCGGACCAAGACGGCGCCGGGACACGACGACGATGTGTCACAGCTC
AGTTTTGCCGTCTTTTCCTGCAGCAATTACCCGGTCGGCTACTTCAACGCCTACGGCAACGCGGCCCGCAAGAAT
AAACACGACTTCGTCCTACACCTGGGCGACTACATCTACGAATACCCCGACATCGGCGAGCGCGCAACCCGGCCA
CAGGACTACCTGTTCACGCTTCACGATTATCGGACACGCCACGGCCAGTACCGCACCGATCCGGACCTGCAACTG
CTTGCGCAGAATTACGCCTGGATACCCACATGGGATGACCACGAGTTTGCCAATAACGGATACCGCGATGGCTTC
AGCGGGCTCAACAACTCCGAGGACTCGTTCTTGCAAACGGGCCGGCAGGTTACTGTGGACAGTCGCAAGGTCAAC
GCGGTGCGGGCGTACTTTGAGTGGATGCCCATTCGACAGGCCGACCCGGACGACGGGCTTCGCGTCTGGCGCTCG
TTTCAGATGGGAAAGCTGCTGGACCTCGTCATCCTCGACACGCGCAATTATGACCGGAGCATCACCTCGCTCGAC
TGGAACGACCATTACATCGATCGCATCCGCAACGACCCCAGCCGTACGCTCATGGGGTCTCGCCAGGAGCGGTGG
TTCTATCGATCGTTGAGCGAGTCCAAGAGCCGCGGCGCGCGATGGCGCATCGTCGGCAATCAGATCGTCTTCTCA
CGCGTCTTGGATAAGACGGGCGCCATGTCCGGCGACGACTGGAACGGTTATCTGGCCAATCGCAACCGCACGTTG
CAGCACCTGTACGGCAACCAGATCGACAACACCATCTTTCTGGCCGGCGACAGCCACGAGAACTGGGTATCGGAC
CTTGCCTGGCTCGGTAACGTCGGCTACAACCGAAACACCGGCAAGGGCGCCATCGGCGTCGAGTTCGCCGGAACA
GCAGTCAGCTCGACAGGGCATCACGGACCGATCGAACCGCGAGTAGGCCAGCGAGCGCGCGGCATGATCAAGCGC
AACGACGAGATGCAATGGCAAGAGGGCTATTACCGCGGGTATTTCGTCCTGACGGTGACGCCGACGGAAGCCAAG
GCCGAGTTCTATGGCACGCCGTCGGTGGCGACACGCAACTCGTGGGAGCTTCCACTGGCCAATTTCACCGTCGTA
GCGGGTGAAAACCACATCGAGCGCCCCGTGGCCGGAGGAAAGGTCGAGTCCGGGGCGGTAAGGAATGGTGCGGTG
CGGCATAGTAATTACTCGCTCGACACGTCGACGGGCGAGTGGAGGGTCATTGGCTTCGACCGCATGTACCTGCGC
GGCGAGGGCGATGATTAG
Gene >Ophio5|6
ATGCGGCTCCGAGCAGTCCAGCTCCTGGTAGCCAATCTGGTGGCGATAACGACGACGGCCACGAAACATGGCTTG
GACGGAAACATCAACTACGGCAGCCCATCCGTTCGGCATCAAGTGCTGGGCATCGACGTCGACGCCGTCTCGCGC
CGAGCCAGGAAGCGATCGGTAACGAAGCCTACGAACCTACACTTCACCCACGGCGTCGCCTCGGGCGATCCCTTC
CCGGATAGTGTCATCATCTGGACCCGAGTGGCGCCTTCGTGGTCGTCGGATCGGAGCGCGGCGCCCGTCAGTGGT
ACGGAGCAGCTTTATAGCCACGACACGGATGCCTTCATCAAGGCGGACCCGAACCCCATATGCGTCATATGGAAG
GTCTTTCAGGCCTTGAGTACGCCCGAGGCCAATATCAGCATCGTCGCCGCCAAGGGTATGGCTTGGACGACGTCG
GATATCGATTATACCGTCAAGGTCGAAGCTCGTGGGCTGAAGCCGCTCACGCAGTATAGCTATCAGTTTACCATT
TGCGACACCGACAAGCACAGCCCTGTCGGCCGGACCAAGACGGCGCCGGGACACGACGACGATGTGTCACAGCTC
AGTTTTGCCGTCTTTTCCTGCAGCAATTACCGTACGGCCTCCCCCCTTTTCGTCCTCCGGGCCCGGCTTCGGCGG
CCCCAACCCGTTTCGGCGATGCTGATCATGTTGGGGGAACGGTAGCGGTCGGCTACTTCAACGCCTACGGCAACG
CGGCCCGCAAGAATAAACACGACTTCGTCCTACACCTGGGCGACTACATCTACGAATACCCCGACATCGGCGAGC
GCGCAACCCGGCCACAGGACTACCTGTTCACGCTTCACGATTATCGGACACGCCACGGCCAGTACCGCACCGATC
CGGACCTGCAACTGCTTGCGCAGAATTACGCCTGGATACCCACATGGGATGACCACGGTCAGTCGACGGCGGTCT
ACTCTGCCGAGGCGAGTAGAAGCGCTGATGAGGCGCAGAGTTTGCCAATAACGGATACCGCGATGGCTTCAGCGG
GCTCAACAACTCCGAGGACTCGTTCTTGCAAACGGGCCGGCAGGTTACTGTGGACAGTCGCAAGGTCAACGCGGT
GCGGGCGTACTTTGAGTGGATGCCCATTCGGTGCGTCCCTGTCGAGAGTAATAAGGCATGGCGTGCTGCTGCTAA
CCCCCCCCGTCCAGACAGGCCGACCCGGACGACGGGCTTCGCGTCTGGCGCTCGTTTCAGATGGGAAAGCTGCTG
GACCTCGTCATCCTCGACACGCGCAATTATGACCGGAGCATCACCTCGCTCGGTAATTGCTTTTGCCGATGGGCC
CCATTGGTTGTCCGAGGCTGACGTGTGGTGACAGACTGGAACGACCATTACATCGATCGCATCCGCAACGACCCC
AGCCGTACGCTCATGGGGTCTCGCCAGGAGCGGTGGTTCTATCGATCGTTGAGCGAGTCCAAGAGCCGCGGCGCG
CGATGGCGCATCGTCGGCAATCAGATCGTCTTCTCACGCGTCTTGGATAAGACGGGCGCCATGTCCGGCGACGAC
TGGAACGCAAGTCTCATTTCCTCTCTTTTGTTCGACGGGCGAGCGAGCTGACACGAGGCACGGAGCAGGGTTATC
TGGCCAATCGCAACCGCACGTTGCAGCACCTGTACGGCAACCAGATCGACAACACCATCTTTCTGGCCGGCGACA
GCCACGAGAACTGGGTAGGACAGTTGGGACATTGGGACGGTTCGACATGAAGTTGACAATCTTCACAGGTATCGG
ACCTTGCCTGGCTCGGTAACGTCGGCTACAACCGAAACACCGGCAAGGGCGCCATCGGCGTCGAGTTCGCCGGAA
CAGCAGTCAGCTCGACAGGGCATCACGGACCGATCGAACCGCGAGTAGGCCAGCGAGCGCGCGGCATGATCAAGC
GCAACGACGAGATGCAATGGCAAGAGGGCTATTACCGCGGGTATTTCGTCCTGACGGTGACGCCGACGGAAGCCA
AGGCCGAGTTCTATGGTGAGTTTACTCGCGCGACGAGGGTGAGGTTGGGCAAACAAAGGCTGACAACAGTCTGTC
CAACAGGCACGCCGTCGGTGGCGACACGCAACTCGTGGGAGCTTCCACTGGCCAATTTCACCGTCGTAGCGGGTG
AAAACCACATCGAGCGCCCCGTGGCCGGAGGAAAGGTCGAGTCCGGGGCGGTAAGGAATGGTGCGGTGCGGCATA
GTAATTACTCGCTCGACACGTCGACGGGCGAGTGGAGGGTCATTGGCTTCGACCGCATGTACCTGCGCGGCGAGG
GCGATGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail