Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5998
Gene name
Locationscaffold_504:10869..13536
Strand-
Gene length (bp)2667
Transcript length (bp)2667
Coding sequence length (bp)2664
Protein length (aa) 888

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 2.8E-16 446 740

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 31 50 19
2 60 82 22
3 94 116 22
4 139 161 22
5 249 271 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5998
MAFVSTFSPARFIGRRLLLLANVARFADRRFALALAAVSVYASKLVHVYAHADALPAHALLLWGPSLFAQDTLLV
LGLRLLFDARLPAPVRGAATAAATVIAVFVTMLAGISISFFTVAGLELHWRNVGAAADASAWRMLLTGLLSMCLV
LVALVLLAGLLQAVCFLVAGMALDMLRWPLTLLPASVRGFGSHLGTGSGSGYRHLLSQHEDDDDEEGDYDDDGSS
TAELGLKSAPAPEVGLTLTIPRRLLATLYILVGLSLLVQTATYLLRPTDSSLVFMSWTLPLLPLVELALSSPALA
RLRGGGTDSLNSNVTALADPPPMSWLPADKQLKGFYDWYFPDRQHYNADRDPIRVSNLERAPLPELRTALRKLRI
RHVVLLELETIRKDVFPLKRDGSIWRRLANGSDSGQLSAEAERRLSTLTPMANLLTGDYDDGFEHEEQPRRGGIN
FVNAHTSSTYTLKSLTATLCGLTPLITDWNLEYQNHIYQPCLPHVFEAMSQLEGIKPPRNDTKSEGGSDDDEDDD
DEDDNDFTSYPWRSTYMQSVTSTFDKQAALMTALGFQPGTVIDKEYLRSRAAKFGPSNVTDNNYFGMPEVALDDY
IRDAFSQARRKNERVFLSHLTSTTHHDWKLPTDEKYVPLTDDSELDSLSHYINCVGYDDRWLGRILDIIREEGAE
DETLVILLGDHGLSNVELGSVSSYGSGNIGNFHVPLVLSHPRLPVIDVDDAVSSIQVLPTVLDLLIESGSLSPSQ
TDAARDLIANYEGQSLIRPQLNGPSRAGLGSWQFSLINPGGTMLAVRERGRPGWRLIVPVIDNVSWRFTDSESSP
HEEETVVAFDLDVFLSDVELMHGQEAAKWVRKAAAVTSWYVDENMERWRFGGKRPKKEPKTTP
Coding >Ophio5|5998
ATGGCCTTCGTCTCAACCTTCTCACCGGCCCGTTTCATCGGTCGTCGACTGCTACTGCTGGCCAATGTCGCCCGG
TTCGCGGATCGTCGCTTCGCTCTGGCCCTAGCTGCCGTCTCCGTCTACGCATCCAAGCTCGTACACGTTTACGCC
CACGCCGATGCGCTTCCGGCTCACGCGCTGCTTCTCTGGGGTCCGTCGCTGTTCGCTCAGGATACGCTGCTCGTT
CTGGGACTGCGATTACTTTTCGATGCCCGGCTGCCGGCCCCGGTCCGGGGCGCCGCCACGGCCGCGGCGACGGTT
ATCGCCGTCTTTGTAACCATGTTGGCCGGCATCAGCATCTCCTTCTTCACCGTCGCTGGATTGGAGCTCCACTGG
CGCAATGTTGGTGCCGCTGCTGACGCCTCGGCCTGGCGTATGCTGTTGACCGGCCTGCTGTCAATGTGTCTTGTC
CTCGTCGCCCTGGTGCTTCTCGCCGGTCTACTGCAGGCAGTTTGCTTTTTAGTCGCCGGCATGGCGCTGGATATG
CTGCGATGGCCGCTGACGCTACTGCCGGCTTCCGTCAGGGGGTTCGGTTCTCATCTGGGCACTGGCTCTGGATCC
GGCTATCGACACCTCCTCTCGCAGCACGAAGACGACGACGATGAAGAAGGCGATTACGACGATGATGGTTCGTCC
ACCGCCGAGCTCGGTCTTAAATCTGCCCCTGCTCCCGAGGTGGGATTGACTTTGACGATACCCCGTCGCCTCCTG
GCGACCCTCTACATCTTGGTCGGCCTCTCGCTGCTGGTCCAGACGGCGACTTATCTGCTGAGGCCAACCGACTCG
TCTCTCGTCTTCATGTCCTGGACGCTTCCTCTGCTACCGCTTGTCGAACTCGCTCTCTCCTCTCCGGCTCTGGCC
AGGCTTCGAGGCGGCGGCACCGACAGTCTCAACAGCAACGTCACGGCGCTGGCCGATCCGCCGCCCATGTCCTGG
CTTCCGGCCGACAAGCAGCTCAAGGGCTTCTACGACTGGTATTTCCCGGACCGGCAGCATTACAATGCCGATCGG
GATCCGATCCGGGTGTCGAACCTCGAGCGGGCTCCATTGCCCGAACTCCGGACGGCCCTGCGCAAGCTGCGGATC
CGGCATGTTGTCTTGCTGGAGCTCGAGACCATTCGCAAGGACGTCTTCCCCCTGAAGCGGGATGGCTCCATCTGG
CGCCGTCTCGCCAACGGGTCTGATTCCGGCCAATTGTCTGCCGAAGCCGAGCGCCGACTGTCAACTCTGACGCCC
ATGGCTAACCTCCTGACGGGCGACTATGACGACGGATTTGAGCATGAGGAGCAGCCTCGACGCGGAGGCATCAAC
TTTGTCAATGCTCACACCAGCAGCACCTACACGCTCAAGAGTCTGACGGCGACCTTGTGCGGTCTGACGCCCCTC
ATCACCGACTGGAACCTCGAATACCAGAATCACATCTATCAGCCCTGTCTTCCGCATGTGTTTGAAGCTATGAGC
CAGCTGGAAGGCATCAAACCTCCTCGCAACGATACCAAGTCCGAAGGGGGCAGCGACGACGACGAAGATGATGAT
GATGAAGATGACAACGACTTCACCTCGTATCCCTGGCGCTCGACCTATATGCAGTCCGTCACGAGCACCTTTGAC
AAGCAGGCCGCCCTGATGACGGCCCTCGGCTTCCAGCCTGGCACCGTCATCGACAAGGAGTATCTTCGCAGCAGA
GCGGCCAAGTTCGGTCCCAGCAATGTGACCGACAACAACTACTTTGGCATGCCCGAGGTGGCCCTGGATGACTAC
ATCCGCGATGCCTTTTCCCAGGCCCGCCGCAAGAATGAGCGCGTCTTTCTCTCCCATCTGACGAGCACTACGCAC
CATGACTGGAAGCTTCCTACCGACGAAAAGTACGTTCCCCTGACGGACGATAGCGAACTCGATAGCCTGTCGCAC
TACATCAATTGCGTCGGCTACGATGACCGCTGGCTTGGTCGTATCCTCGATATTATCCGGGAGGAGGGCGCCGAA
GACGAGACTCTCGTCATTCTCCTCGGCGATCACGGCCTATCCAACGTCGAGCTGGGCAGTGTCTCGTCATATGGC
AGCGGCAATATTGGCAACTTTCACGTGCCCCTTGTCCTGTCACATCCGCGGCTCCCTGTCATCGACGTCGACGAT
GCCGTCTCCTCGATACAGGTGTTGCCAACCGTTCTCGACCTCCTCATCGAGAGCGGTTCGCTATCTCCGTCTCAG
ACCGACGCTGCCCGCGACCTCATCGCCAACTACGAGGGCCAGTCCCTGATCCGACCGCAACTAAACGGTCCCAGC
CGCGCCGGCCTGGGCTCCTGGCAATTCAGCCTCATCAATCCAGGCGGAACCATGCTCGCCGTTCGTGAGCGTGGA
CGTCCGGGTTGGAGGCTGATTGTCCCCGTTATCGACAACGTGAGCTGGCGCTTCACCGACTCCGAATCCAGTCCT
CACGAGGAGGAGACCGTCGTCGCCTTCGACCTCGACGTCTTCCTCTCCGACGTCGAGCTCATGCATGGCCAGGAG
GCTGCCAAATGGGTTCGCAAGGCTGCTGCCGTCACGAGCTGGTATGTCGACGAGAACATGGAGCGGTGGCGCTTC
GGCGGTAAGAGGCCGAAAAAGGAGCCCAAAACTACCCCT
Transcript >Ophio5|5998
ATGGCCTTCGTCTCAACCTTCTCACCGGCCCGTTTCATCGGTCGTCGACTGCTACTGCTGGCCAATGTCGCCCGG
TTCGCGGATCGTCGCTTCGCTCTGGCCCTAGCTGCCGTCTCCGTCTACGCATCCAAGCTCGTACACGTTTACGCC
CACGCCGATGCGCTTCCGGCTCACGCGCTGCTTCTCTGGGGTCCGTCGCTGTTCGCTCAGGATACGCTGCTCGTT
CTGGGACTGCGATTACTTTTCGATGCCCGGCTGCCGGCCCCGGTCCGGGGCGCCGCCACGGCCGCGGCGACGGTT
ATCGCCGTCTTTGTAACCATGTTGGCCGGCATCAGCATCTCCTTCTTCACCGTCGCTGGATTGGAGCTCCACTGG
CGCAATGTTGGTGCCGCTGCTGACGCCTCGGCCTGGCGTATGCTGTTGACCGGCCTGCTGTCAATGTGTCTTGTC
CTCGTCGCCCTGGTGCTTCTCGCCGGTCTACTGCAGGCAGTTTGCTTTTTAGTCGCCGGCATGGCGCTGGATATG
CTGCGATGGCCGCTGACGCTACTGCCGGCTTCCGTCAGGGGGTTCGGTTCTCATCTGGGCACTGGCTCTGGATCC
GGCTATCGACACCTCCTCTCGCAGCACGAAGACGACGACGATGAAGAAGGCGATTACGACGATGATGGTTCGTCC
ACCGCCGAGCTCGGTCTTAAATCTGCCCCTGCTCCCGAGGTGGGATTGACTTTGACGATACCCCGTCGCCTCCTG
GCGACCCTCTACATCTTGGTCGGCCTCTCGCTGCTGGTCCAGACGGCGACTTATCTGCTGAGGCCAACCGACTCG
TCTCTCGTCTTCATGTCCTGGACGCTTCCTCTGCTACCGCTTGTCGAACTCGCTCTCTCCTCTCCGGCTCTGGCC
AGGCTTCGAGGCGGCGGCACCGACAGTCTCAACAGCAACGTCACGGCGCTGGCCGATCCGCCGCCCATGTCCTGG
CTTCCGGCCGACAAGCAGCTCAAGGGCTTCTACGACTGGTATTTCCCGGACCGGCAGCATTACAATGCCGATCGG
GATCCGATCCGGGTGTCGAACCTCGAGCGGGCTCCATTGCCCGAACTCCGGACGGCCCTGCGCAAGCTGCGGATC
CGGCATGTTGTCTTGCTGGAGCTCGAGACCATTCGCAAGGACGTCTTCCCCCTGAAGCGGGATGGCTCCATCTGG
CGCCGTCTCGCCAACGGGTCTGATTCCGGCCAATTGTCTGCCGAAGCCGAGCGCCGACTGTCAACTCTGACGCCC
ATGGCTAACCTCCTGACGGGCGACTATGACGACGGATTTGAGCATGAGGAGCAGCCTCGACGCGGAGGCATCAAC
TTTGTCAATGCTCACACCAGCAGCACCTACACGCTCAAGAGTCTGACGGCGACCTTGTGCGGTCTGACGCCCCTC
ATCACCGACTGGAACCTCGAATACCAGAATCACATCTATCAGCCCTGTCTTCCGCATGTGTTTGAAGCTATGAGC
CAGCTGGAAGGCATCAAACCTCCTCGCAACGATACCAAGTCCGAAGGGGGCAGCGACGACGACGAAGATGATGAT
GATGAAGATGACAACGACTTCACCTCGTATCCCTGGCGCTCGACCTATATGCAGTCCGTCACGAGCACCTTTGAC
AAGCAGGCCGCCCTGATGACGGCCCTCGGCTTCCAGCCTGGCACCGTCATCGACAAGGAGTATCTTCGCAGCAGA
GCGGCCAAGTTCGGTCCCAGCAATGTGACCGACAACAACTACTTTGGCATGCCCGAGGTGGCCCTGGATGACTAC
ATCCGCGATGCCTTTTCCCAGGCCCGCCGCAAGAATGAGCGCGTCTTTCTCTCCCATCTGACGAGCACTACGCAC
CATGACTGGAAGCTTCCTACCGACGAAAAGTACGTTCCCCTGACGGACGATAGCGAACTCGATAGCCTGTCGCAC
TACATCAATTGCGTCGGCTACGATGACCGCTGGCTTGGTCGTATCCTCGATATTATCCGGGAGGAGGGCGCCGAA
GACGAGACTCTCGTCATTCTCCTCGGCGATCACGGCCTATCCAACGTCGAGCTGGGCAGTGTCTCGTCATATGGC
AGCGGCAATATTGGCAACTTTCACGTGCCCCTTGTCCTGTCACATCCGCGGCTCCCTGTCATCGACGTCGACGAT
GCCGTCTCCTCGATACAGGTGTTGCCAACCGTTCTCGACCTCCTCATCGAGAGCGGTTCGCTATCTCCGTCTCAG
ACCGACGCTGCCCGCGACCTCATCGCCAACTACGAGGGCCAGTCCCTGATCCGACCGCAACTAAACGGTCCCAGC
CGCGCCGGCCTGGGCTCCTGGCAATTCAGCCTCATCAATCCAGGCGGAACCATGCTCGCCGTTCGTGAGCGTGGA
CGTCCGGGTTGGAGGCTGATTGTCCCCGTTATCGACAACGTGAGCTGGCGCTTCACCGACTCCGAATCCAGTCCT
CACGAGGAGGAGACCGTCGTCGCCTTCGACCTCGACGTCTTCCTCTCCGACGTCGAGCTCATGCATGGCCAGGAG
GCTGCCAAATGGGTTCGCAAGGCTGCTGCCGTCACGAGCTGGTATGTCGACGAGAACATGGAGCGGTGGCGCTTC
GGCGGTAAGAGGCCGAAAAAGGAGCCCAAAACTACCCCTTGA
Gene >Ophio5|5998
ATGGCCTTCGTCTCAACCTTCTCACCGGCCCGTTTCATCGGTCGTCGACTGCTACTGCTGGCCAATGTCGCCCGG
TTCGCGGATCGTCGCTTCGCTCTGGCCCTAGCTGCCGTCTCCGTCTACGCATCCAAGCTCGTACACGTTTACGCC
CACGCCGATGCGCTTCCGGCTCACGCGCTGCTTCTCTGGGGTCCGTCGCTGTTCGCTCAGGATACGCTGCTCGTT
CTGGGACTGCGATTACTTTTCGATGCCCGGCTGCCGGCCCCGGTCCGGGGCGCCGCCACGGCCGCGGCGACGGTT
ATCGCCGTCTTTGTAACCATGTTGGCCGGCATCAGCATCTCCTTCTTCACCGTCGCTGGATTGGAGCTCCACTGG
CGCAATGTTGGTGCCGCTGCTGACGCCTCGGCCTGGCGTATGCTGTTGACCGGCCTGCTGTCAATGTGTCTTGTC
CTCGTCGCCCTGGTGCTTCTCGCCGGTCTACTGCAGGCAGTTTGCTTTTTAGTCGCCGGCATGGCGCTGGATATG
CTGCGATGGCCGCTGACGCTACTGCCGGCTTCCGTCAGGGGGTTCGGTTCTCATCTGGGCACTGGCTCTGGATCC
GGCTATCGACACCTCCTCTCGCAGCACGAAGACGACGACGATGAAGAAGGCGATTACGACGATGATGGTTCGTCC
ACCGCCGAGCTCGGTCTTAAATCTGCCCCTGCTCCCGAGGTGGGATTGACTTTGACGATACCCCGTCGCCTCCTG
GCGACCCTCTACATCTTGGTCGGCCTCTCGCTGCTGGTCCAGACGGCGACTTATCTGCTGAGGCCAACCGACTCG
TCTCTCGTCTTCATGTCCTGGACGCTTCCTCTGCTACCGCTTGTCGAACTCGCTCTCTCCTCTCCGGCTCTGGCC
AGGCTTCGAGGCGGCGGCACCGACAGTCTCAACAGCAACGTCACGGCGCTGGCCGATCCGCCGCCCATGTCCTGG
CTTCCGGCCGACAAGCAGCTCAAGGGCTTCTACGACTGGTATTTCCCGGACCGGCAGCATTACAATGCCGATCGG
GATCCGATCCGGGTGTCGAACCTCGAGCGGGCTCCATTGCCCGAACTCCGGACGGCCCTGCGCAAGCTGCGGATC
CGGCATGTTGTCTTGCTGGAGCTCGAGACCATTCGCAAGGACGTCTTCCCCCTGAAGCGGGATGGCTCCATCTGG
CGCCGTCTCGCCAACGGGTCTGATTCCGGCCAATTGTCTGCCGAAGCCGAGCGCCGACTGTCAACTCTGACGCCC
ATGGCTAACCTCCTGACGGGCGACTATGACGACGGATTTGAGCATGAGGAGCAGCCTCGACGCGGAGGCATCAAC
TTTGTCAATGCTCACACCAGCAGCACCTACACGCTCAAGAGTCTGACGGCGACCTTGTGCGGTCTGACGCCCCTC
ATCACCGACTGGAACCTCGAATACCAGAATCACATCTATCAGCCCTGTCTTCCGCATGTGTTTGAAGCTATGAGC
CAGCTGGAAGGCATCAAACCTCCTCGCAACGATACCAAGTCCGAAGGGGGCAGCGACGACGACGAAGATGATGAT
GATGAAGATGACAACGACTTCACCTCGTATCCCTGGCGCTCGACCTATATGCAGTCCGTCACGAGCACCTTTGAC
AAGCAGGCCGCCCTGATGACGGCCCTCGGCTTCCAGCCTGGCACCGTCATCGACAAGGAGTATCTTCGCAGCAGA
GCGGCCAAGTTCGGTCCCAGCAATGTGACCGACAACAACTACTTTGGCATGCCCGAGGTGGCCCTGGATGACTAC
ATCCGCGATGCCTTTTCCCAGGCCCGCCGCAAGAATGAGCGCGTCTTTCTCTCCCATCTGACGAGCACTACGCAC
CATGACTGGAAGCTTCCTACCGACGAAAAGTACGTTCCCCTGACGGACGATAGCGAACTCGATAGCCTGTCGCAC
TACATCAATTGCGTCGGCTACGATGACCGCTGGCTTGGTCGTATCCTCGATATTATCCGGGAGGAGGGCGCCGAA
GACGAGACTCTCGTCATTCTCCTCGGCGATCACGGCCTATCCAACGTCGAGCTGGGCAGTGTCTCGTCATATGGC
AGCGGCAATATTGGCAACTTTCACGTGCCCCTTGTCCTGTCACATCCGCGGCTCCCTGTCATCGACGTCGACGAT
GCCGTCTCCTCGATACAGGTGTTGCCAACCGTTCTCGACCTCCTCATCGAGAGCGGTTCGCTATCTCCGTCTCAG
ACCGACGCTGCCCGCGACCTCATCGCCAACTACGAGGGCCAGTCCCTGATCCGACCGCAACTAAACGGTCCCAGC
CGCGCCGGCCTGGGCTCCTGGCAATTCAGCCTCATCAATCCAGGCGGAACCATGCTCGCCGTTCGTGAGCGTGGA
CGTCCGGGTTGGAGGCTGATTGTCCCCGTTATCGACAACGTGAGCTGGCGCTTCACCGACTCCGAATCCAGTCCT
CACGAGGAGGAGACCGTCGTCGCCTTCGACCTCGACGTCTTCCTCTCCGACGTCGAGCTCATGCATGGCCAGGAG
GCTGCCAAATGGGTTCGCAAGGCTGCTGCCGTCACGAGCTGGTATGTCGACGAGAACATGGAGCGGTGGCGCTTC
GGCGGTAAGAGGCCGAAAAAGGAGCCCAAAACTACCCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail