Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5980
Gene name
Locationscaffold_502:321..2893
Strand+
Gene length (bp)2572
Transcript length (bp)2394
Coding sequence length (bp)2391
Protein length (aa) 797

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 7.8E-169 101 750

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 31 797 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 80 775 0.0E+00
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 80 788 1.0E-156
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 66 766 6.0E-155
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 80 788 7.0E-152
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 31 797 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 80 775 0.0E+00
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 80 788 1.0E-156
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 66 766 6.0E-155
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 80 788 7.0E-152
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 42 777 1.0E-148
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 71 788 1.0E-148
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 68 769 5.0E-146
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 82 788 1.0E-145
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 70 768 2.0E-145
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 68 771 3.0E-142
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 86 781 1.0E-132
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 10 769 2.0E-121
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 28 780 1.0E-95
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 103 125 22
2 130 152 22
3 176 198 22
4 210 229 19
5 233 255 22
6 276 298 22
7 318 340 22
8 349 371 22
9 423 445 22
10 477 496 19
11 501 523 22
12 549 571 22
13 586 608 22
14 653 675 22
15 701 720 19
16 733 755 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5980
MGLKDRFGVRASEMAAEASGSEIRPTVSADHNPDRELRRFRKQHKWDPFLDIDKLDNIDEALASGNADKEAAIDE
SLIQEDSPYPEVRSSVPPHDIDVPVNTIRAWFIGSFLCTVVAACNILLNLRRTPISITSTVVQLVAYPIGVGWAR
IMPDVSFTLFGHTWALNPGPFNVKEHTLITMMTAAGSSISYSIDILLAQEIFYKQEFKWGFQILLMLSTQAMGFG
VAGVARRFLVWPSSMVWPATLITCTVMYSLHDHRPSDPATTNGWRIGRYKFFLIVAIATFGWEWFPLVIAPFLSL
FMFATWIAPTNVVVNQIFGGQSGLGLLPISFDWSVVTAFLTSPLQTPAFAIFNVFAGIMLTTLGAIGLAWAGPDF
YRYLPLSANQNFDRFAEPYNTSRILTPDFTVNETAYRAYSPILLGPTFSLSYGLSFATLISTITHVALFYGSDVW
NRAWDSKYEEPDVHLKLMRKYREAPEWWFLSIFAVSFAFGMIASQFWKTNLTWWAYIVCILIGVTLFIPIGMVQA
ITNQQTGLNVITEMIIGYMMPGRPVAMMLFKSWGYMLSYNGLTYISDMKVGHYMKIPPRSMFAAQAFAVVWLSFV
QISTYNFLRGNIEGICTPTQSQGLTCPNARTFYNASVIWGVIGPRKVFGAGSIYAWTNWFWLIGFAVPVIQFFAA
RRWPRSWARYLVSPALFGAAGMMPPATLFYLFQWVIVGLIFNCFIRRRFFGWWSRYNYPLSGALDIGTALCTVVA
GLGLGLSETQFPQWWGTTVVGNTLDANNSAVTRVFVEGQQPIGPSSW
Coding >Ophio5|5980
ATGGGCCTCAAGGACCGCTTCGGCGTCCGGGCAAGTGAGATGGCTGCCGAAGCGTCGGGTTCCGAGATCCGGCCG
ACCGTCTCGGCCGATCACAACCCGGATCGCGAGCTGCGTCGCTTCAGGAAGCAGCACAAATGGGATCCTTTTCTC
GATATCGACAAATTGGATAACATCGATGAGGCTCTCGCTTCAGGCAACGCAGACAAGGAGGCGGCCATTGATGAG
TCGCTGATCCAGGAGGACTCGCCGTATCCTGAAGTTCGCTCTTCGGTGCCACCTCATGACATTGATGTGCCCGTC
AATACGATTCGCGCCTGGTTCATTGGTAGCTTTCTCTGCACCGTCGTCGCCGCCTGCAACATCCTCCTCAACTTG
CGCCGGACGCCCATCTCCATTACCTCGACCGTCGTTCAGCTGGTGGCCTACCCCATCGGCGTTGGCTGGGCTCGC
ATCATGCCTGACGTCTCCTTCACCCTCTTCGGCCACACCTGGGCCCTCAATCCGGGCCCCTTCAATGTCAAGGAG
CACACTCTCATCACCATGATGACGGCTGCCGGCTCCTCCATCAGCTACTCCATCGACATTCTACTCGCCCAGGAA
ATTTTCTACAAGCAAGAGTTCAAATGGGGCTTCCAGATCCTCCTCATGTTATCCACCCAGGCCATGGGCTTTGGT
GTCGCCGGTGTCGCCCGTCGTTTTCTCGTCTGGCCCTCGTCCATGGTCTGGCCGGCTACACTCATCACCTGCACC
GTCATGTACTCGCTTCACGATCATCGGCCCTCGGACCCGGCCACGACCAACGGCTGGAGAATCGGCCGGTACAAG
TTCTTCCTCATCGTCGCCATCGCCACCTTTGGCTGGGAGTGGTTTCCCCTCGTCATCGCCCCCTTTTTGTCTCTC
TTCATGTTCGCCACCTGGATCGCGCCCACAAACGTCGTCGTCAACCAAATCTTTGGTGGACAGTCGGGTCTCGGC
CTGCTTCCCATCTCCTTTGACTGGTCCGTCGTCACCGCCTTCCTCACCTCGCCGCTCCAGACGCCGGCCTTCGCC
ATCTTCAACGTCTTCGCAGGCATCATGCTCACCACCCTTGGCGCCATCGGCCTCGCCTGGGCCGGCCCCGACTTC
TACCGCTACTTGCCCCTGAGCGCCAACCAAAACTTTGACCGCTTCGCTGAGCCTTACAACACCAGCCGTATCCTC
ACGCCCGACTTCACCGTCAACGAGACGGCTTACCGCGCCTACTCGCCCATCCTGCTCGGCCCGACCTTTTCGCTC
TCGTACGGCCTGTCGTTTGCTACCCTCATTTCTACAATCACGCACGTCGCCCTCTTTTACGGCTCCGACGTCTGG
AACCGCGCTTGGGACTCAAAGTACGAGGAACCCGACGTACACCTCAAGCTGATGCGCAAGTACCGGGAAGCTCCC
GAATGGTGGTTCCTCTCCATCTTCGCCGTCAGCTTCGCCTTTGGCATGATTGCCAGCCAGTTCTGGAAGACCAAC
TTGACTTGGTGGGCTTACATTGTCTGCATCCTCATTGGCGTCACCCTGTTCATCCCCATTGGCATGGTCCAGGCC
ATTACCAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATTATCGGCTACATGATGCCCGGCCGACCCGTC
GCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCGTACAACGGCCTGACGTACATTTCCGACATGAAGGTC
GGCCACTACATGAAGATTCCGCCGCGGAGCATGTTTGCCGCCCAGGCCTTTGCCGTCGTCTGGCTGTCCTTTGTC
CAGATCTCCACGTACAACTTTTTGCGTGGCAACATCGAGGGCATCTGTACCCCGACGCAGTCCCAGGGCCTGACG
TGTCCCAACGCCAGGACCTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGGCCGAGGAAGGTGTTTGGCGCC
GGCAGCATCTACGCTTGGACAAATTGGTTCTGGCTCATCGGCTTCGCCGTGCCCGTCATTCAGTTCTTTGCCGCT
CGACGTTGGCCGAGGTCGTGGGCTCGCTACCTCGTCTCCCCCGCCTTGTTTGGCGCCGCCGGCATGATGCCACCC
GCCACGCTGTTCTACCTGTTCCAGTGGGTCATTGTCGGGCTCATCTTTAACTGCTTCATCCGCCGACGCTTCTTT
GGCTGGTGGTCTCGCTATAACTATCCACTCTCGGGTGCGCTCGACATCGGCACGGCCTTGTGCACCGTCGTCGCC
GGGCTCGGCTTGGGCCTTAGTGAGACTCAATTCCCCCAGTGGTGGGGCACAACGGTCGTCGGCAACACGCTCGAC
GCCAATAACTCGGCCGTTACCAGGGTCTTCGTCGAGGGGCAGCAGCCCATCGGGCCGTCGAGCTGG
Transcript >Ophio5|5980
ATGGGCCTCAAGGACCGCTTCGGCGTCCGGGCAAGTGAGATGGCTGCCGAAGCGTCGGGTTCCGAGATCCGGCCG
ACCGTCTCGGCCGATCACAACCCGGATCGCGAGCTGCGTCGCTTCAGGAAGCAGCACAAATGGGATCCTTTTCTC
GATATCGACAAATTGGATAACATCGATGAGGCTCTCGCTTCAGGCAACGCAGACAAGGAGGCGGCCATTGATGAG
TCGCTGATCCAGGAGGACTCGCCGTATCCTGAAGTTCGCTCTTCGGTGCCACCTCATGACATTGATGTGCCCGTC
AATACGATTCGCGCCTGGTTCATTGGTAGCTTTCTCTGCACCGTCGTCGCCGCCTGCAACATCCTCCTCAACTTG
CGCCGGACGCCCATCTCCATTACCTCGACCGTCGTTCAGCTGGTGGCCTACCCCATCGGCGTTGGCTGGGCTCGC
ATCATGCCTGACGTCTCCTTCACCCTCTTCGGCCACACCTGGGCCCTCAATCCGGGCCCCTTCAATGTCAAGGAG
CACACTCTCATCACCATGATGACGGCTGCCGGCTCCTCCATCAGCTACTCCATCGACATTCTACTCGCCCAGGAA
ATTTTCTACAAGCAAGAGTTCAAATGGGGCTTCCAGATCCTCCTCATGTTATCCACCCAGGCCATGGGCTTTGGT
GTCGCCGGTGTCGCCCGTCGTTTTCTCGTCTGGCCCTCGTCCATGGTCTGGCCGGCTACACTCATCACCTGCACC
GTCATGTACTCGCTTCACGATCATCGGCCCTCGGACCCGGCCACGACCAACGGCTGGAGAATCGGCCGGTACAAG
TTCTTCCTCATCGTCGCCATCGCCACCTTTGGCTGGGAGTGGTTTCCCCTCGTCATCGCCCCCTTTTTGTCTCTC
TTCATGTTCGCCACCTGGATCGCGCCCACAAACGTCGTCGTCAACCAAATCTTTGGTGGACAGTCGGGTCTCGGC
CTGCTTCCCATCTCCTTTGACTGGTCCGTCGTCACCGCCTTCCTCACCTCGCCGCTCCAGACGCCGGCCTTCGCC
ATCTTCAACGTCTTCGCAGGCATCATGCTCACCACCCTTGGCGCCATCGGCCTCGCCTGGGCCGGCCCCGACTTC
TACCGCTACTTGCCCCTGAGCGCCAACCAAAACTTTGACCGCTTCGCTGAGCCTTACAACACCAGCCGTATCCTC
ACGCCCGACTTCACCGTCAACGAGACGGCTTACCGCGCCTACTCGCCCATCCTGCTCGGCCCGACCTTTTCGCTC
TCGTACGGCCTGTCGTTTGCTACCCTCATTTCTACAATCACGCACGTCGCCCTCTTTTACGGCTCCGACGTCTGG
AACCGCGCTTGGGACTCAAAGTACGAGGAACCCGACGTACACCTCAAGCTGATGCGCAAGTACCGGGAAGCTCCC
GAATGGTGGTTCCTCTCCATCTTCGCCGTCAGCTTCGCCTTTGGCATGATTGCCAGCCAGTTCTGGAAGACCAAC
TTGACTTGGTGGGCTTACATTGTCTGCATCCTCATTGGCGTCACCCTGTTCATCCCCATTGGCATGGTCCAGGCC
ATTACCAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATTATCGGCTACATGATGCCCGGCCGACCCGTC
GCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCGTACAACGGCCTGACGTACATTTCCGACATGAAGGTC
GGCCACTACATGAAGATTCCGCCGCGGAGCATGTTTGCCGCCCAGGCCTTTGCCGTCGTCTGGCTGTCCTTTGTC
CAGATCTCCACGTACAACTTTTTGCGTGGCAACATCGAGGGCATCTGTACCCCGACGCAGTCCCAGGGCCTGACG
TGTCCCAACGCCAGGACCTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGGCCGAGGAAGGTGTTTGGCGCC
GGCAGCATCTACGCTTGGACAAATTGGTTCTGGCTCATCGGCTTCGCCGTGCCCGTCATTCAGTTCTTTGCCGCT
CGACGTTGGCCGAGGTCGTGGGCTCGCTACCTCGTCTCCCCCGCCTTGTTTGGCGCCGCCGGCATGATGCCACCC
GCCACGCTGTTCTACCTGTTCCAGTGGGTCATTGTCGGGCTCATCTTTAACTGCTTCATCCGCCGACGCTTCTTT
GGCTGGTGGTCTCGCTATAACTATCCACTCTCGGGTGCGCTCGACATCGGCACGGCCTTGTGCACCGTCGTCGCC
GGGCTCGGCTTGGGCCTTAGTGAGACTCAATTCCCCCAGTGGTGGGGCACAACGGTCGTCGGCAACACGCTCGAC
GCCAATAACTCGGCCGTTACCAGGGTCTTCGTCGAGGGGCAGCAGCCCATCGGGCCGTCGAGCTGGTAG
Gene >Ophio5|5980
ATGGGCCTCAAGGACCGCTTCGGCGTCCGGGCAAGTGAGATGGCTGCCGAAGCGTCGGGTTCCGAGATCCGGCCG
ACCGTCTCGGCCGATCACAACCCGGATCGCGAGCTGCGTCGCTTCAGGAAGCAGCACAAATGGGATCCTTTTCTC
GATATCGACAAATTGGATAACATCGATGAGGCTCTCGCTTCAGGCAACGCAGACAAGGAGGCGGCCATTGATGAG
TCGCTGATCCAGGAGGACTCGCCGTATCCTGAAGTTCGCTCTTCGGTGCGTCTCGTCTTGGACTTCAAACATGAT
CAACGTCTTCTCTGACAGCTCTCGCAGGTGCCACCTCATGACATTGATGTGCCCGTCAATACGATTCGCGCCTGG
TTCATTGGTAGCTTTCTCTGCACCGTCGTCGCCGCCTGCAACATCCTCCTCAACTTGCGCCGGACGCCCATCTCC
ATTACCTCGACCGTCGTTCAGCTGGTGGCCTACCCGTGAGAAGCTCTCCCAGGGACTGCATCTCTTCTTGCCTCG
CATCATCTGACTCTCCCTAGCATCGGCGTTGGCTGGGCTCGCATCATGCCTGACGTCTCCTTCACCCTCTTCGGC
CACACCTGGGCCCTCAATCCGGGCCCCTTCAATGTCAAGGAGCACACTCTCATCACCATGATGACGGCTGCCGGC
TCCTCCATCAGCTACTCCATCGACATTCTACTCGCCCAGGAAATTTTCTACAAGCAAGAGTTCAAATGGGGCTTC
CAGATCCTCCTCATGTTATCCACCCAGGCCATGGGCTTTGGTGTCGCCGGTGTCGCCCGTCGTTTTCTCGTCTGG
CCCTCGTCCATGGTCTGGCCGGCTACACTCATCACCTGCACCGTCATGTACTCGCTTCACGATCATCGGCCCTCG
GACCCGGCCACGACCAACGGCTGGAGAATCGGCCGGTACAAGTTCTTCCTCATCGTCGCCATCGCCACCTTTGGC
TGGGAGTGGTTTCCCCTCGTCATCGCCCCCTTTTTGTCTCTCTTCATGTTCGCCACCTGGATCGCGCCCACAAAC
GTCGTCGTCAACCAAATCTTTGGTGGACAGTCGGGTCTCGGCCTGCTTCCCATCTCCTTTGACTGGTCCGTCGTC
ACCGCCTTCCTCACCTCGCCGCTCCAGACGCCGGCCTTCGCCATCTTCAACGTCTTCGCAGGCATCATGCTCACC
ACCCTTGGCGCCATCGGCCTCGCCTGGGCCGGCCCCGACTTCTACCGCTACTTGCCCCTGAGCGCCAACCAAAAC
TTTGACCGCTTCGCTGAGCCTTACAACACCAGCCGTATCCTCACGCCCGACTTCACCGTCAACGAGACGGCTTAC
CGCGCCTACTCGCCCATCCTGCTCGGCCCGACCTTTTCGCTCTCGTACGGCCTGTCGTTTGCTACCCTCATTTCT
ACAATCACGCACGTCGCCCTCTTTTACGGCTCCGACGTCTGGAACCGCGCTTGGGACTCAAAGTACGAGGAACCC
GACGTACACCTCAAGCTGATGCGCAAGTACCGGGAAGCTCCCGAATGGTGGTTCCTCTCCATCTTCGCCGTCAGC
TTCGCCTTTGGCATGATTGCCAGCCAGTTCTGGAAGACCAACTTGACTTGGTGGGCTTACATTGTCTGCATCCTC
ATTGGCGTCACCCTGTTCATCCCCATTGGCATGGTCCAGGCCATTACCAACCAGCAGACGGGCCTCAACGTCATC
ACCGAGATGATTATCGGCTACATGATGCCCGGCCGACCCGTCGCCATGATGCTCTTCAAGTCGTGGGGCTACATG
CTGTCGTACAACGGCCTGACGTACATTTCCGACATGAAGGTCGGCCACTACATGAAGATTCCGCCGCGGAGCATG
TTTGCCGCCCAGGCCTTTGCCGTCGTCTGGCTGTCCTTTGTCCAGATCTCCACGTACAACTTTTTGCGTGGCAAC
ATCGAGGGCATCTGTACCCCGACGCAGTCCCAGGGCCTGACGTGTCCCAACGCCAGGACCTTTTACAACGCCAGC
GTCATCTGGGGCGTCATCGGGCCGAGGAAGGTGTTTGGCGCCGGCAGCATCTACGCTTGGACAAATTGGTTCTGG
CTCATCGGCTTCGCCGTGCCCGTCATTCAGTTCTTTGCCGCTCGACGTTGGCCGAGGTCGTGGGCTCGCTACCTC
GTCTCCCCCGCCTTGTTTGGCGCCGCCGGCATGATGCCACCCGCCACGCTGTTCTACCTGTTCCAGTGGGTCATT
GTCGGGCTCATCTTTAACTGCTTCATCCGCCGACGCTTCTTTGGCTGGTGGTGTGAGTTCTTTCCACCCCCCTTG
ATTTTGCTAGTCTGGTCGGCTGACGGTGTGGTCGGCAGCTCGCTATAACTATCCACTCTCGGGTGCGCTCGACAT
CGGCACGGCCTTGTGCACCGTCGTCGCCGGGCTCGGCTTGGGCCTTAGTGAGACTCAATTCCCCCAGTGGTGGGG
CACAACGGTCGTCGGCAACACGCTCGACGCCAATAACTCGGCCGTTACCAGGGTCTTCGTCGAGGGGCAGCAGCC
CATCGGGCCGTCGAGCTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail