Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5960
Gene name
Locationscaffold_50:48103..49536
Strand-
Gene length (bp)1433
Transcript length (bp)1374
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 1.6E-24 116 340

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 2 215 1.0E-18
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 21 216 5.0E-18
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 43 218 7.0E-18
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 24 223 7.0E-18
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 16 215 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 2 215 1.0E-18
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 21 216 5.0E-18
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 43 218 7.0E-18
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 24 223 7.0E-18
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 16 215 3.0E-15
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 19 218 5.0E-14
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 5 218 5.0E-13
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 7 218 4.0E-10
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 25 342 3.0E-09
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 44 208 3.0E-08
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 129 342 6.0E-08
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 77 221 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22
2 68 90 22
3 111 133 22
4 202 224 22
5 289 311 22
6 316 338 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5960
MAQSGSSSTSQHSSLRLAVSYAFDWIVLIIVVVIAGFLGRIEPQKRPFSLDDPNISFPFTEHQAVPTWLLVVLCG
LVPAVIILIISVLLVPGATVPKKTPQALIWKRKLWEIHVGWLGLLLSVGSAFFFISGIKNMCGKPRPDLLSRCEP
DLARRDMYRVGGFAGEAAGALLYSGKICQQADKYKLDDGFRSYPSGHSATAAAGLIYLSLYLASKFAVTIPFIVP
NPNKRDEASSLVAFPSRANDEAANYGAECYGYSSSGKPGNAAQRSAQHNVKIQSVRRQAAAPPIYLLVITLVPLC
LAIFIAASRWFDFRHHGFDILFGFLIGTITAIYSFRYYHMPIQAGAGWAWGSRSGDRAFWAGVGRLGYVGDRADF
DARVDRADLGESADLDMQPTQVSAAPSSGGVNYRPAHYATGAPHNGSFQDVELDRMERHHHAMGQQQAMGGPAHP
SAIRGYQ
Coding >Ophio5|5960
ATGGCCCAGTCCGGGTCGTCGTCGACGAGTCAGCACTCGTCTCTGCGCCTCGCCGTCTCTTATGCCTTCGACTGG
ATAGTCCTCATCATCGTCGTCGTCATCGCTGGTTTCCTCGGTCGCATCGAACCTCAGAAGCGACCTTTTTCCCTC
GACGACCCAAACATTTCATTCCCCTTCACCGAGCATCAGGCGGTGCCGACATGGCTGCTCGTCGTTCTGTGCGGT
CTTGTGCCCGCCGTCATCATACTCATCATCTCCGTTCTCCTTGTGCCCGGCGCCACGGTTCCCAAGAAAACGCCT
CAGGCGCTGATATGGAAGCGTAAGCTATGGGAGATTCATGTTGGCTGGCTCGGTCTTTTGCTCTCCGTCGGCTCC
GCCTTCTTCTTCATCAGCGGCATCAAGAACATGTGCGGCAAGCCGCGCCCGGATCTGCTGTCGCGCTGCGAGCCC
GATCTCGCTCGCCGCGACATGTACCGCGTCGGTGGTTTCGCAGGCGAGGCAGCTGGCGCCCTTCTTTACTCGGGT
AAGATCTGCCAGCAGGCGGACAAGTACAAGCTCGACGACGGCTTCCGCAGCTATCCCAGCGGTCACTCTGCTACC
GCCGCCGCCGGACTCATCTATCTGTCCCTCTATCTCGCCAGCAAGTTCGCCGTCACGATCCCGTTCATCGTCCCC
AACCCCAATAAGCGTGACGAAGCCTCGTCGCTCGTCGCCTTCCCCTCGCGCGCCAACGATGAAGCGGCCAACTAC
GGCGCCGAATGTTATGGCTATTCGTCCTCGGGCAAGCCCGGCAATGCCGCCCAGCGCAGTGCTCAGCACAATGTC
AAGATCCAGTCGGTACGCCGACAGGCGGCCGCGCCACCCATCTACCTCCTCGTCATCACCCTCGTGCCCCTTTGT
CTAGCCATCTTTATCGCGGCGTCCCGCTGGTTCGACTTCCGCCACCACGGCTTCGATATCCTCTTCGGCTTCCTC
ATCGGTACCATCACGGCCATTTACAGCTTCCGCTACTACCACATGCCCATCCAGGCCGGCGCCGGCTGGGCGTGG
GGCTCCCGCAGCGGCGACCGCGCCTTCTGGGCCGGCGTCGGCCGTCTTGGCTACGTCGGCGACCGCGCCGACTTC
GATGCCCGCGTCGACCGCGCCGACCTCGGCGAGTCTGCCGACTTGGACATGCAGCCGACCCAGGTGTCGGCCGCG
CCGTCCTCGGGAGGCGTCAATTACCGCCCTGCGCATTATGCGACGGGAGCGCCACACAATGGCTCCTTCCAAGAC
GTCGAGCTCGACCGGATGGAGCGCCACCATCACGCCATGGGCCAGCAGCAGGCCATGGGCGGACCGGCGCACCCG
TCCGCCATCCGGGGCTACCAG
Transcript >Ophio5|5960
ATGGCCCAGTCCGGGTCGTCGTCGACGAGTCAGCACTCGTCTCTGCGCCTCGCCGTCTCTTATGCCTTCGACTGG
ATAGTCCTCATCATCGTCGTCGTCATCGCTGGTTTCCTCGGTCGCATCGAACCTCAGAAGCGACCTTTTTCCCTC
GACGACCCAAACATTTCATTCCCCTTCACCGAGCATCAGGCGGTGCCGACATGGCTGCTCGTCGTTCTGTGCGGT
CTTGTGCCCGCCGTCATCATACTCATCATCTCCGTTCTCCTTGTGCCCGGCGCCACGGTTCCCAAGAAAACGCCT
CAGGCGCTGATATGGAAGCGTAAGCTATGGGAGATTCATGTTGGCTGGCTCGGTCTTTTGCTCTCCGTCGGCTCC
GCCTTCTTCTTCATCAGCGGCATCAAGAACATGTGCGGCAAGCCGCGCCCGGATCTGCTGTCGCGCTGCGAGCCC
GATCTCGCTCGCCGCGACATGTACCGCGTCGGTGGTTTCGCAGGCGAGGCAGCTGGCGCCCTTCTTTACTCGGGT
AAGATCTGCCAGCAGGCGGACAAGTACAAGCTCGACGACGGCTTCCGCAGCTATCCCAGCGGTCACTCTGCTACC
GCCGCCGCCGGACTCATCTATCTGTCCCTCTATCTCGCCAGCAAGTTCGCCGTCACGATCCCGTTCATCGTCCCC
AACCCCAATAAGCGTGACGAAGCCTCGTCGCTCGTCGCCTTCCCCTCGCGCGCCAACGATGAAGCGGCCAACTAC
GGCGCCGAATGTTATGGCTATTCGTCCTCGGGCAAGCCCGGCAATGCCGCCCAGCGCAGTGCTCAGCACAATGTC
AAGATCCAGTCGGTACGCCGACAGGCGGCCGCGCCACCCATCTACCTCCTCGTCATCACCCTCGTGCCCCTTTGT
CTAGCCATCTTTATCGCGGCGTCCCGCTGGTTCGACTTCCGCCACCACGGCTTCGATATCCTCTTCGGCTTCCTC
ATCGGTACCATCACGGCCATTTACAGCTTCCGCTACTACCACATGCCCATCCAGGCCGGCGCCGGCTGGGCGTGG
GGCTCCCGCAGCGGCGACCGCGCCTTCTGGGCCGGCGTCGGCCGTCTTGGCTACGTCGGCGACCGCGCCGACTTC
GATGCCCGCGTCGACCGCGCCGACCTCGGCGAGTCTGCCGACTTGGACATGCAGCCGACCCAGGTGTCGGCCGCG
CCGTCCTCGGGAGGCGTCAATTACCGCCCTGCGCATTATGCGACGGGAGCGCCACACAATGGCTCCTTCCAAGAC
GTCGAGCTCGACCGGATGGAGCGCCACCATCACGCCATGGGCCAGCAGCAGGCCATGGGCGGACCGGCGCACCCG
TCCGCCATCCGGGGCTACCAGTGA
Gene >Ophio5|5960
ATGGCCCAGTCCGGGTCGTCGTCGACGAGTCAGCACTCGTCTCTGCGCCTCGCCGTCTCTTATGCCTTCGACTGG
ATAGTCCTCATCATCGTCGTCGTCATCGCTGGTTTCCTCGGTCGCATCGAACCTCAGAAGCGACCTTTTTCCCTC
GACGACCCAAACATTTCGTCCGTGCCGAGGACACCCTTGCCTGCAGCGTATCCAGTCGCTAACACATGAGCTTCA
GATTCCCCTTCACCGAGCATCAGGCGGTGCCGACATGGCTGCTCGTCGTTCTGTGCGGTCTTGTGCCCGCCGTCA
TCATACTCATCATCTCCGTTCTCCTTGTGCCCGGCGCCACGGTTCCCAAGAAAACGCCTCAGGCGCTGATATGGA
AGCGTAAGCTATGGGAGATTCATGTTGGCTGGCTCGGTCTTTTGCTCTCCGTCGGCTCCGCCTTCTTCTTCATCA
GCGGCATCAAGAACATGTGCGGCAAGCCGCGCCCGGATCTGCTGTCGCGCTGCGAGCCCGATCTCGCTCGCCGCG
ACATGTACCGCGTCGGTGGTTTCGCAGGCGAGGCAGCTGGCGCCCTTCTTTACTCGGGTAAGATCTGCCAGCAGG
CGGACAAGTACAAGCTCGACGACGGCTTCCGCAGCTATCCCAGCGGTCACTCTGCTACCGCCGCCGCCGGACTCA
TCTATCTGTCCCTCTATCTCGCCAGCAAGTTCGCCGTCACGATCCCGTTCATCGTCCCCAACCCCAATAAGCGTG
ACGAAGCCTCGTCGCTCGTCGCCTTCCCCTCGCGCGCCAACGATGAAGCGGCCAACTACGGCGCCGAATGTTATG
GCTATTCGTCCTCGGGCAAGCCCGGCAATGCCGCCCAGCGCAGTGCTCAGCACAATGTCAAGATCCAGTCGGTAC
GCCGACAGGCGGCCGCGCCACCCATCTACCTCCTCGTCATCACCCTCGTGCCCCTTTGTCTAGCCATCTTTATCG
CGGCGTCCCGCTGGTTCGACTTCCGCCACCACGGCTTCGATATCCTCTTCGGCTTCCTCATCGGTACCATCACGG
CCATTTACAGCTTCCGCTACTACCACATGCCCATCCAGGCCGGCGCCGGCTGGGCGTGGGGCTCCCGCAGCGGCG
ACCGCGCCTTCTGGGCCGGCGTCGGCCGTCTTGGCTACGTCGGCGACCGCGCCGACTTCGATGCCCGCGTCGACC
GCGCCGACCTCGGCGAGTCTGCCGACTTGGACATGCAGCCGACCCAGGTGTCGGCCGCGCCGTCCTCGGGAGGCG
TCAATTACCGCCCTGCGCATTATGCGACGGGAGCGCCACACAATGGCTCCTTCCAAGACGTCGAGCTCGACCGGA
TGGAGCGCCACCATCACGCCATGGGCCAGCAGCAGGCCATGGGCGGACCGGCGCACCCGTCCGCCATCCGGGGCT
ACCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail