Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5955
Gene name
Locationscaffold_50:34568..36456
Strand+
Gene length (bp)1888
Transcript length (bp)1761
Coding sequence length (bp)1758
Protein length (aa) 586

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 2.7E-95 194 533
PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like 1.4E-27 22 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUH6|HEX1_ARTBC Beta-hexosaminidase ARB_07893 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07893 PE=1 SV=1 21 573 8.0E-145
sp|Q9SYK0|HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana GN=HEXO2 PE=1 SV=1 2 581 2.0E-84
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 5 586 3.0E-74
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 1 583 5.0E-70
sp|D4AYT4|HEX2_ARTBC Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01353 PE=1 SV=1 134 586 2.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUH6|HEX1_ARTBC Beta-hexosaminidase ARB_07893 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07893 PE=1 SV=1 21 573 8.0E-145
sp|Q9SYK0|HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana GN=HEXO2 PE=1 SV=1 2 581 2.0E-84
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 5 586 3.0E-74
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 1 583 5.0E-70
sp|D4AYT4|HEX2_ARTBC Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01353 PE=1 SV=1 134 586 2.0E-69
sp|P49010|HEXC_BOMMO Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori PE=1 SV=1 135 576 3.0E-64
sp|Q8WSF3|FDL_DROME Probable beta-hexosaminidase fdl OS=Drosophila melanogaster GN=fdl PE=1 SV=1 136 581 3.0E-64
sp|A7WM73|HEXO1_ARATH Beta-hexosaminidase 1 OS=Arabidopsis thaliana GN=HEXO1 PE=1 SV=1 1 572 7.0E-58
sp|Q8L7S6|HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana GN=HEXO3 PE=1 SV=1 2 568 3.0E-56
sp|P20060|HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus musculus GN=Hexb PE=1 SV=2 8 574 7.0E-53
sp|Q54K55|HEXB1_DICDI Beta-hexosaminidase subunit B1 OS=Dictyostelium discoideum GN=hexb1 PE=3 SV=1 136 569 7.0E-51
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens GN=HEXB PE=1 SV=3 1 575 1.0E-50
sp|Q54K56|HEXB2_DICDI Beta-hexosaminidase subunit B2 OS=Dictyostelium discoideum GN=hexb2 PE=3 SV=1 22 569 2.0E-50
sp|Q6AXR4|HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus GN=Hexb PE=2 SV=1 5 574 2.0E-50
sp|P49614|HEXB_FELCA Beta-hexosaminidase subunit beta OS=Felis catus GN=HEXB PE=2 SV=2 136 573 3.0E-49
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 3 585 5.0E-49
sp|Q29548|HEXB_PIG Beta-hexosaminidase subunit beta OS=Sus scrofa GN=HEXB PE=1 SV=2 19 575 8.0E-45
sp|Q0V8R6|HEXA_BOVIN Beta-hexosaminidase subunit alpha OS=Bos taurus GN=HEXA PE=2 SV=1 130 573 2.0E-43
sp|P29416|HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus musculus GN=Hexa PE=1 SV=2 101 575 9.0E-43
sp|Q641X3|HEXA_RAT Beta-hexosaminidase subunit alpha OS=Rattus norvegicus GN=Hexa PE=2 SV=1 137 575 1.0E-42
sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens GN=HEXA PE=1 SV=2 137 575 2.0E-42
sp|Q5RC84|HEXA_PONAB Beta-hexosaminidase subunit alpha OS=Pongo abelii GN=HEXA PE=3 SV=1 137 575 2.0E-42
sp|Q22492|HEXA_CAEEL Beta-hexosaminidase A OS=Caenorhabditis elegans GN=hex-1 PE=1 SV=1 113 586 1.0E-41
sp|Q619W7|HEXA_CAEBR Beta-hexosaminidase A OS=Caenorhabditis briggsae GN=hex-1 PE=3 SV=2 137 586 7.0E-41
sp|Q54SC9|HEXA2_DICDI Beta-hexosaminidase subunit A2 OS=Dictyostelium discoideum GN=hexa2 PE=3 SV=1 135 585 4.0E-40
sp|Q86M34|HEXB_ENTHI Beta-hexosaminidase subunit beta OS=Entamoeba histolytica GN=HEXB PE=1 SV=1 113 534 3.0E-39
sp|P49009|HEXA_ENTHI Beta-hexosaminidase subunit alpha OS=Entamoeba histolytica GN=HEXA PE=1 SV=2 136 532 2.0E-37
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 149 525 4.0E-32
sp|Q7WUL4|HEX20_CELFI Beta-N-acetylhexosaminidase OS=Cellulomonas fimi GN=hex20 PE=1 SV=1 136 536 2.0E-29
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 136 551 2.0E-29
sp|P13670|CHB_VIBHA N,N'-diacetylchitobiase OS=Vibrio harveyi GN=chb PE=1 SV=1 138 288 1.0E-18
sp|Q04786|HEX_VIBVL Beta-hexosaminidase OS=Vibrio vulnificus GN=hex PE=3 SV=1 127 288 3.0E-18
sp|Q54468|CHB_SERMA Chitobiase OS=Serratia marcescens GN=chb PE=1 SV=1 158 377 2.0E-17
sp|P49007|HEXB_PSEO7 Beta-hexosaminidase B OS=Pseudoalteromonas piscicida GN=nag096 PE=3 SV=1 132 297 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1099 0.0596 0.8848 0.1511 0.1261 0.0838 0.3357 0.4367 0.2134 0.006

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999751

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH20 1.3E-90 188 533

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup299
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3143
Ophiocordyceps australis map64 (Brazil) OphauB2|2608
Ophiocordyceps australis map64 (Brazil) OphauB2|7170
Ophiocordyceps camponoti-floridani Ophcf2|04392
Ophiocordyceps camponoti-floridani Ophcf2|06719
Ophiocordyceps camponoti-rufipedis Ophun1|3912
Ophiocordyceps kimflemingae Ophio5|3678
Ophiocordyceps kimflemingae Ophio5|5955 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10290
Ophiocordyceps subramaniannii Hirsu2|5838

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5955
MVIPLAALALAAVVAPDTAYALWPAPQKLSMGKEVLFIDEGVRVTYNGHSLSRNLDYTSPPPGHQLSSEQIVQSA
VSRALKAIFKDNFVPWKLRPRHSDFEPDAHGTNKKLIKSIAIFQTHADDAQTFKPRDGQVDESYTLDVSSGGLVK
VQCKSSTGCLHGLETLVQLFFEHSAGDCWYTPHAPVSIQDGPKYPHRGVHLDVARMWYPLADIKRTIDAMAWSKM
NRLHLHITDSQSWPLEIPALPRLAEKGAYRKGLSYSPSDIAALYEYAIYRGVSIIMEMDMPGHFGVVDLAYEDLV
VAYNQKPYQWFCAEPPCGALRMNSPKVYDFVDKLFDDLLPRVAKYSAYFHTGGDELNKNDSKLDPGVGTNDPAVI
QPLLQKFINHAHEKVHKAGLTPMVWEEMATEWNMTLGRDVVIQSWLGNGAVKKLVKAGHKVIDSDYKFWYLDCGR
GQWLNIENGPAFQRYYPFNDWCWPTKSWRLVYSHDPRAGLSAKEAELVLGGEVAIWSELMDSTNVDSIIWPRASA
AGEVLWSGRQDASGQNRSQYDAAPRLAEFRERMVARGVMAMPVQMIFCTQGTPEDCAMTMD
Coding >Ophio5|5955
ATGGTCATCCCTCTGGCAGCTCTCGCCCTGGCGGCCGTGGTCGCGCCGGACACGGCTTACGCGCTATGGCCCGCC
CCCCAGAAGCTGTCGATGGGAAAAGAGGTACTGTTCATTGACGAGGGCGTCAGGGTCACATACAATGGACACTCT
CTGTCCCGCAATCTCGACTATACCAGCCCTCCGCCCGGTCACCAGCTCAGCAGCGAGCAGATCGTGCAGTCGGCC
GTGTCCCGCGCGCTCAAGGCCATCTTCAAAGACAACTTCGTGCCCTGGAAGCTGCGTCCGCGGCATTCGGATTTT
GAGCCCGACGCTCACGGGACTAATAAGAAGTTGATCAAGTCTATTGCCATCTTCCAGACCCATGCCGACGATGCC
CAAACCTTCAAGCCCCGCGACGGCCAAGTCGACGAATCCTACACGCTCGATGTGTCCAGCGGGGGTCTGGTCAAG
GTGCAGTGCAAGTCGTCGACCGGCTGTCTGCACGGACTCGAGACGCTGGTCCAGCTCTTCTTCGAGCATAGCGCT
GGCGACTGCTGGTATACGCCGCACGCGCCCGTGTCCATCCAAGATGGACCCAAATACCCCCATCGCGGCGTTCAT
CTCGACGTGGCCCGCATGTGGTACCCTCTCGCCGACATCAAGAGGACCATCGATGCCATGGCCTGGAGTAAGATG
AATCGGTTACACCTGCACATTACCGATTCGCAGTCGTGGCCGCTGGAGATCCCCGCCCTGCCGCGGCTGGCCGAG
AAGGGTGCGTATCGGAAGGGCCTATCGTACTCGCCGTCGGATATCGCGGCTCTATATGAGTACGCGATTTACCGC
GGAGTCTCTATCATCATGGAGATGGATATGCCGGGTCATTTTGGTGTGGTCGACCTCGCATACGAAGACCTCGTT
GTCGCTTACAACCAGAAGCCGTATCAATGGTTCTGCGCAGAGCCGCCGTGCGGAGCGCTGCGGATGAACAGCCCG
AAAGTGTACGACTTCGTAGACAAGCTGTTCGATGACCTGCTGCCGAGGGTGGCCAAGTATTCGGCCTACTTCCAC
ACCGGCGGCGACGAGCTCAACAAGAACGACTCGAAGCTCGACCCAGGCGTCGGCACCAACGACCCGGCCGTGATT
CAGCCTCTTCTCCAGAAATTCATCAACCACGCGCACGAAAAGGTCCACAAGGCCGGGCTGACGCCCATGGTGTGG
GAAGAGATGGCGACGGAGTGGAACATGACGTTGGGGCGAGACGTGGTGATCCAGTCGTGGCTGGGCAACGGGGCG
GTCAAGAAGCTGGTCAAGGCAGGCCATAAAGTGATTGACAGCGACTATAAGTTCTGGTATCTGGACTGCGGCAGA
GGCCAATGGCTCAACATCGAGAACGGGCCTGCCTTCCAGCGATACTATCCCTTCAACGACTGGTGCTGGCCGACG
AAGAGCTGGCGGCTGGTCTACTCCCACGACCCTCGGGCCGGGCTGTCAGCCAAGGAGGCGGAGCTGGTGCTCGGG
GGCGAGGTGGCCATCTGGAGCGAGCTGATGGACAGCACCAACGTGGACAGCATCATCTGGCCGCGAGCCAGCGCC
GCCGGAGAGGTGCTCTGGTCGGGCCGGCAGGACGCGTCCGGTCAGAACCGCAGCCAGTACGACGCGGCCCCGCGA
CTGGCCGAGTTCCGGGAGCGGATGGTGGCCCGCGGAGTCATGGCGATGCCGGTGCAGATGATCTTCTGCACGCAG
GGGACGCCCGAGGACTGCGCCATGACGATGGAT
Transcript >Ophio5|5955
ATGGTCATCCCTCTGGCAGCTCTCGCCCTGGCGGCCGTGGTCGCGCCGGACACGGCTTACGCGCTATGGCCCGCC
CCCCAGAAGCTGTCGATGGGAAAAGAGGTACTGTTCATTGACGAGGGCGTCAGGGTCACATACAATGGACACTCT
CTGTCCCGCAATCTCGACTATACCAGCCCTCCGCCCGGTCACCAGCTCAGCAGCGAGCAGATCGTGCAGTCGGCC
GTGTCCCGCGCGCTCAAGGCCATCTTCAAAGACAACTTCGTGCCCTGGAAGCTGCGTCCGCGGCATTCGGATTTT
GAGCCCGACGCTCACGGGACTAATAAGAAGTTGATCAAGTCTATTGCCATCTTCCAGACCCATGCCGACGATGCC
CAAACCTTCAAGCCCCGCGACGGCCAAGTCGACGAATCCTACACGCTCGATGTGTCCAGCGGGGGTCTGGTCAAG
GTGCAGTGCAAGTCGTCGACCGGCTGTCTGCACGGACTCGAGACGCTGGTCCAGCTCTTCTTCGAGCATAGCGCT
GGCGACTGCTGGTATACGCCGCACGCGCCCGTGTCCATCCAAGATGGACCCAAATACCCCCATCGCGGCGTTCAT
CTCGACGTGGCCCGCATGTGGTACCCTCTCGCCGACATCAAGAGGACCATCGATGCCATGGCCTGGAGTAAGATG
AATCGGTTACACCTGCACATTACCGATTCGCAGTCGTGGCCGCTGGAGATCCCCGCCCTGCCGCGGCTGGCCGAG
AAGGGTGCGTATCGGAAGGGCCTATCGTACTCGCCGTCGGATATCGCGGCTCTATATGAGTACGCGATTTACCGC
GGAGTCTCTATCATCATGGAGATGGATATGCCGGGTCATTTTGGTGTGGTCGACCTCGCATACGAAGACCTCGTT
GTCGCTTACAACCAGAAGCCGTATCAATGGTTCTGCGCAGAGCCGCCGTGCGGAGCGCTGCGGATGAACAGCCCG
AAAGTGTACGACTTCGTAGACAAGCTGTTCGATGACCTGCTGCCGAGGGTGGCCAAGTATTCGGCCTACTTCCAC
ACCGGCGGCGACGAGCTCAACAAGAACGACTCGAAGCTCGACCCAGGCGTCGGCACCAACGACCCGGCCGTGATT
CAGCCTCTTCTCCAGAAATTCATCAACCACGCGCACGAAAAGGTCCACAAGGCCGGGCTGACGCCCATGGTGTGG
GAAGAGATGGCGACGGAGTGGAACATGACGTTGGGGCGAGACGTGGTGATCCAGTCGTGGCTGGGCAACGGGGCG
GTCAAGAAGCTGGTCAAGGCAGGCCATAAAGTGATTGACAGCGACTATAAGTTCTGGTATCTGGACTGCGGCAGA
GGCCAATGGCTCAACATCGAGAACGGGCCTGCCTTCCAGCGATACTATCCCTTCAACGACTGGTGCTGGCCGACG
AAGAGCTGGCGGCTGGTCTACTCCCACGACCCTCGGGCCGGGCTGTCAGCCAAGGAGGCGGAGCTGGTGCTCGGG
GGCGAGGTGGCCATCTGGAGCGAGCTGATGGACAGCACCAACGTGGACAGCATCATCTGGCCGCGAGCCAGCGCC
GCCGGAGAGGTGCTCTGGTCGGGCCGGCAGGACGCGTCCGGTCAGAACCGCAGCCAGTACGACGCGGCCCCGCGA
CTGGCCGAGTTCCGGGAGCGGATGGTGGCCCGCGGAGTCATGGCGATGCCGGTGCAGATGATCTTCTGCACGCAG
GGGACGCCCGAGGACTGCGCCATGACGATGGATTAG
Gene >Ophio5|5955
ATGGTCATCCCTCTGGCAGCTCTCGCCCTGGCGGCCGTGGTCGCGCCGGACACGGCTTACGCGCTATGGCCCGCC
CCCCAGAAGCTGTCGATGGGAAAAGAGGTACTGTTCATTGACGAGGGCGTCAGGGTCACATACAATGGACACTCT
GTATGAACCCCCTTCTCCGGGCTTTGGCCGTGCCGTGCAAGTCACGCTGACCAAAGGCGAAGCTGTCCCGCAATC
TCGACTATACCAGCCCTCCGCCCGGTCACCAGCTCAGCAGCGAGCAGATCGTGCAGTCGGCCGTGTCCCGCGCGC
TCAAGGCCATCTTCAAAGACAACTTCGTGCCCTGGAAGCTGCGTCCGCGGCATTCGGATTTTGAGCCCGACGCTC
ACGGGACTAATAAGAAGTTGATCAAGTCTATTGCCATCTTCCAGACCCATGCCGACGATGCCCAAACCTTCAAGC
CCCGCGACGGCCAAGTCGACGAATCCTACACGCTCGATGTGTCCAGCGGGGGTCTGGTCAAGGTGCAGTGCAAGT
CGTCGACCGGCTGTCTGCACGGACTCGAGACGCTGGTCCAGCTCTTCTTCGAGCATAGCGCTGGCGACTGCTGGT
ATACGCCGCACGCGCCCGTGTCCATCCAAGATGGACCCAAATACCCCCATCGCGGCGTTCATCTCGACGTGGCCC
GCATGTGGTACCCTCTCGCCGACATCAAGAGGACCATCGATGCCATGGCCTGGAGTAAGATGAATCGGTTACACC
TGCACATTACCGATTCGCAGTCGTGGCCGCTGGAGATCCCCGCCCTGCCGCGGCTGGCCGAGAAGGGTGCGTATC
GGAAGGGCCTATCGTACTCGCCGTCGGATATCGCGGCTCTATATGAGTACGCGATTTACCGCGGAGTCTCTATCA
TCATGGAGATGGATATGCCGGGTCATTTTGGTGTGGTCGACCTCGCATACGAAGACCTCGTTGTCGCTTACAACC
AGAAGCCGTATCAATGGTTCTGCGCAGAGCCGCCGTGCGGAGCGCTGCGGATGAACAGCCCGAAAGTGTACGACT
TCGTAGACAAGCTGTTCGATGACCTGCTGCCGAGGGTGGCCAAGTATTCGGCCTACTTCCACACCGGCGGCGACG
AGCTCAACAAGAACGACTCGAAGCTCGACCCAGGCGTCGGCACCAACGACCCGGCCGTGATTCAGCCTCTTCTCC
AGAAATTCATCAACCACGCGCACGAAAAGGTCCACAAGGCCGGGCTGACGCCCATGGTGTGGGAAGAGATGGCGA
CGGAGTGGAACATGACGTTGGGGCGAGACGTGGTGATCCAGTCGTGGCTGGGCAACGGGGCGGTCAAGAAGCTGG
TCAAGGCAGGCCATAAAGTGATTGACAGCGACTATAAGTTCTGGGTAAGCAGGCCTTGGGGGGGGGGGGGAATGA
ATCATATCATCCAACGGCTAACGGGAGAGCAAAGTATCTGGACTGCGGCAGAGGCCAATGGCTCAACATCGAGAA
CGGGCCTGCCTTCCAGCGATACTATCCCTTCAACGACTGGTGCTGGCCGACGAAGAGCTGGCGGCTGGTCTACTC
CCACGACCCTCGGGCCGGGCTGTCAGCCAAGGAGGCGGAGCTGGTGCTCGGGGGCGAGGTGGCCATCTGGAGCGA
GCTGATGGACAGCACCAACGTGGACAGCATCATCTGGCCGCGAGCCAGCGCCGCCGGAGAGGTGCTCTGGTCGGG
CCGGCAGGACGCGTCCGGTCAGAACCGCAGCCAGTACGACGCGGCCCCGCGACTGGCCGAGTTCCGGGAGCGGAT
GGTGGCCCGCGGAGTCATGGCGATGCCGGTGCAGATGATCTTCTGCACGCAGGGGACGCCCGAGGACTGCGCCAT
GACGATGGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail