Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5939
Gene name
Locationscaffold_50:632..1577
Strand+
Gene length (bp)945
Transcript length (bp)945
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 109 314 6.0E-14
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 213 313 6.0E-08
sp|P12255|FHAB_BORPE Filamentous hemagglutinin OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=fhaB PE=1 SV=4 57 179 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5939
MKSTASVAFLAALAAAQPFPRPEMMEPRAMVTKTAWVTEVQYVTEVIDSTTTLWITATPVPVNKEPVDAPVRYVE
PSYAPPPPPAPKPHQPSPPPVEQPKTTEAASPPPPPPPPPPPPPASKPTPTPTPAPYTPPPPAPAPAPSSSASPP
PPPPPPPPPAPPVKPSYVPPPPPPPPPPPPAPKPVPLPAPVPVLPAAAQYAESGKRTGAAPAKFSGQITYYTVGM
GSCGFDDSGKDQTGNIVAISKDKMGTQSNGNPMCGQTISIHANGKTTQATVRDKCMGCSENNIDVNEKVFKELFG
SLDGGRMPVTWSFN
Coding >Ophio5|5939
ATGAAGTCGACTGCTTCCGTCGCCTTTCTTGCGGCCCTTGCCGCCGCTCAGCCTTTTCCCCGTCCTGAAATGATG
GAGCCGCGCGCCATGGTGACCAAGACGGCTTGGGTGACCGAGGTCCAGTATGTTACCGAAGTCATTGACTCGACC
ACCACCCTCTGGATCACCGCTACCCCCGTCCCGGTCAACAAGGAACCCGTCGACGCTCCCGTTCGCTACGTCGAG
CCGTCTTACGCGCCACCTCCGCCTCCGGCCCCTAAGCCGCATCAGCCCTCGCCCCCTCCGGTCGAACAGCCCAAG
ACAACCGAGGCCGCGTCTCCTCCGCCCCCGCCTCCTCCGCCCCCGCCCCCGCCGCCGGCCTCCAAGCCCACACCC
ACGCCCACGCCCGCACCCTACACACCTCCGCCGCCAGCTCCGGCTCCCGCCCCGTCTTCTTCGGCCTCTCCCCCA
CCTCCTCCGCCTCCGCCTCCGCCTCCTGCGCCGCCCGTGAAGCCGTCCTACGTGCCTCCTCCTCCTCCTCCCCCT
CCTCCCCCGCCGCCGGCCCCCAAACCCGTCCCGCTTCCGGCTCCGGTCCCGGTCCTGCCCGCGGCGGCCCAGTAC
GCCGAAAGCGGCAAACGCACGGGCGCCGCCCCCGCCAAGTTCAGCGGTCAAATCACCTACTACACCGTCGGCATG
GGCTCCTGCGGCTTCGACGACTCGGGTAAGGACCAGACGGGCAACATCGTCGCCATCTCCAAGGACAAGATGGGC
ACCCAATCCAACGGCAACCCCATGTGCGGCCAGACCATCAGCATCCACGCCAACGGCAAGACGACGCAAGCCACT
GTTCGGGACAAGTGCATGGGCTGCTCCGAGAACAACATCGACGTCAATGAAAAGGTCTTCAAGGAGCTTTTCGGC
AGCCTAGACGGTGGCCGTATGCCCGTCACCTGGTCTTTCAAT
Transcript >Ophio5|5939
ATGAAGTCGACTGCTTCCGTCGCCTTTCTTGCGGCCCTTGCCGCCGCTCAGCCTTTTCCCCGTCCTGAAATGATG
GAGCCGCGCGCCATGGTGACCAAGACGGCTTGGGTGACCGAGGTCCAGTATGTTACCGAAGTCATTGACTCGACC
ACCACCCTCTGGATCACCGCTACCCCCGTCCCGGTCAACAAGGAACCCGTCGACGCTCCCGTTCGCTACGTCGAG
CCGTCTTACGCGCCACCTCCGCCTCCGGCCCCTAAGCCGCATCAGCCCTCGCCCCCTCCGGTCGAACAGCCCAAG
ACAACCGAGGCCGCGTCTCCTCCGCCCCCGCCTCCTCCGCCCCCGCCCCCGCCGCCGGCCTCCAAGCCCACACCC
ACGCCCACGCCCGCACCCTACACACCTCCGCCGCCAGCTCCGGCTCCCGCCCCGTCTTCTTCGGCCTCTCCCCCA
CCTCCTCCGCCTCCGCCTCCGCCTCCTGCGCCGCCCGTGAAGCCGTCCTACGTGCCTCCTCCTCCTCCTCCCCCT
CCTCCCCCGCCGCCGGCCCCCAAACCCGTCCCGCTTCCGGCTCCGGTCCCGGTCCTGCCCGCGGCGGCCCAGTAC
GCCGAAAGCGGCAAACGCACGGGCGCCGCCCCCGCCAAGTTCAGCGGTCAAATCACCTACTACACCGTCGGCATG
GGCTCCTGCGGCTTCGACGACTCGGGTAAGGACCAGACGGGCAACATCGTCGCCATCTCCAAGGACAAGATGGGC
ACCCAATCCAACGGCAACCCCATGTGCGGCCAGACCATCAGCATCCACGCCAACGGCAAGACGACGCAAGCCACT
GTTCGGGACAAGTGCATGGGCTGCTCCGAGAACAACATCGACGTCAATGAAAAGGTCTTCAAGGAGCTTTTCGGC
AGCCTAGACGGTGGCCGTATGCCCGTCACCTGGTCTTTCAATTAG
Gene >Ophio5|5939
ATGAAGTCGACTGCTTCCGTCGCCTTTCTTGCGGCCCTTGCCGCCGCTCAGCCTTTTCCCCGTCCTGAAATGATG
GAGCCGCGCGCCATGGTGACCAAGACGGCTTGGGTGACCGAGGTCCAGTATGTTACCGAAGTCATTGACTCGACC
ACCACCCTCTGGATCACCGCTACCCCCGTCCCGGTCAACAAGGAACCCGTCGACGCTCCCGTTCGCTACGTCGAG
CCGTCTTACGCGCCACCTCCGCCTCCGGCCCCTAAGCCGCATCAGCCCTCGCCCCCTCCGGTCGAACAGCCCAAG
ACAACCGAGGCCGCGTCTCCTCCGCCCCCGCCTCCTCCGCCCCCGCCCCCGCCGCCGGCCTCCAAGCCCACACCC
ACGCCCACGCCCGCACCCTACACACCTCCGCCGCCAGCTCCGGCTCCCGCCCCGTCTTCTTCGGCCTCTCCCCCA
CCTCCTCCGCCTCCGCCTCCGCCTCCTGCGCCGCCCGTGAAGCCGTCCTACGTGCCTCCTCCTCCTCCTCCCCCT
CCTCCCCCGCCGCCGGCCCCCAAACCCGTCCCGCTTCCGGCTCCGGTCCCGGTCCTGCCCGCGGCGGCCCAGTAC
GCCGAAAGCGGCAAACGCACGGGCGCCGCCCCCGCCAAGTTCAGCGGTCAAATCACCTACTACACCGTCGGCATG
GGCTCCTGCGGCTTCGACGACTCGGGTAAGGACCAGACGGGCAACATCGTCGCCATCTCCAAGGACAAGATGGGC
ACCCAATCCAACGGCAACCCCATGTGCGGCCAGACCATCAGCATCCACGCCAACGGCAAGACGACGCAAGCCACT
GTTCGGGACAAGTGCATGGGCTGCTCCGAGAACAACATCGACGTCAATGAAAAGGTCTTCAAGGAGCTTTTCGGC
AGCCTAGACGGTGGCCGTATGCCCGTCACCTGGTCTTTCAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail