Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5935
Gene name
Locationscaffold_5:99930..101599
Strand-
Gene length (bp)1669
Transcript length (bp)1485
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05978 UNC-93 Ion channel regulatory protein UNC-93 1.2E-11 99 290

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8LG53|UN932_ARATH UNC93-like protein 2 OS=Arabidopsis thaliana GN=At1g18010 PE=2 SV=2 50 472 2.0E-93
sp|Q56WD3|UN931_ARATH UNC93-like protein 1 OS=Arabidopsis thaliana GN=At1g18000 PE=2 SV=2 50 472 2.0E-93
sp|Q9URX1|YLX5_SCHPO UNC93-like protein C922.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.05c PE=3 SV=1 50 481 3.0E-88
sp|O14237|YEL4_SCHPO Uncharacterized membrane protein C6F6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.04c PE=4 SV=1 56 445 2.0E-41

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 92 114 22
3 145 167 22
4 180 202 22
5 212 234 22
6 269 291 22
7 311 333 22
8 340 357 17
9 387 409 22
10 450 472 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5935
MTAAGHHDRPKRPASMVKDMQTETIQNVEIRDGAQLELGGNAKSTLIRLYGHPWTQILLISLICFCLPGMYNALA
GLGGCGQVDSAVAANATVAMLSTMAITSLFIAGPLFAWAGPRISLMAGGWTYALYSGSLLNFNRTGNGALVIASG
AILGVGASLLWIVQGAIMTAYVDESRKGRAIAIFWVVFNLGGGIGSLASFGLNYNSAKGSVSSATYVALMIVMLF
GWSLGLLLCSPSRVRGAAPAPKSVSSRPRRRIIIDAARTLVHVLCTRRVACMLPLFFSANLFYSYQQNSVNGDTF
NIHTRSLNGAFYWLSQMVGGLFIGLVLDLSCLGRRGRARLGWSIAFVLGLVIWGGGYKFQVWQNERLARNQRQDV
DFRDSALAAGPMALYAFYGAYDALWQAFAYWLIGTESNSPARAAILVGAYKGLQAAGGSIAWRVNATGVSPMTEL
AMNWGLCIGSLLVVLPVVWTVSASTGDEKDESEKGMNSKEETGV
Coding >Ophio5|5935
ATGACGGCGGCAGGGCATCACGATAGGCCCAAGAGGCCCGCGTCCATGGTCAAAGACATGCAGACGGAGACGATT
CAGAATGTCGAGATTCGCGACGGTGCTCAGCTCGAGCTGGGCGGCAATGCCAAATCGACTTTGATCCGGCTCTAT
GGTCACCCTTGGACCCAGATTCTACTTATTAGCTTGATCTGCTTCTGTCTTCCTGGCATGTACAACGCTCTAGCC
GGCCTCGGAGGCTGCGGCCAAGTCGACTCAGCCGTAGCAGCCAACGCGACGGTAGCCATGCTCTCGACCATGGCC
ATCACCTCGCTCTTCATCGCCGGCCCGCTCTTCGCCTGGGCCGGCCCGCGCATCAGTCTCATGGCCGGCGGCTGG
ACGTACGCGCTCTACAGCGGCAGCCTGCTTAACTTCAACCGGACCGGAAACGGCGCGCTGGTCATCGCCTCGGGC
GCCATCCTCGGCGTCGGCGCCTCGCTGTTGTGGATCGTTCAGGGGGCCATCATGACGGCCTACGTCGACGAGTCT
CGCAAGGGTCGTGCCATTGCCATCTTCTGGGTCGTCTTCAACCTCGGCGGCGGCATCGGCTCGCTCGCCTCCTTT
GGACTCAACTATAACTCGGCCAAGGGTTCCGTCTCTAGCGCGACGTACGTCGCCCTCATGATCGTCATGCTCTTT
GGCTGGTCCCTCGGCCTATTGCTGTGCTCACCCTCGCGCGTCCGTGGAGCGGCACCGGCACCGAAGTCAGTCTCG
TCTCGGCCCCGACGCCGGATCATCATCGACGCCGCAAGGACATTGGTCCACGTTCTCTGCACCCGACGCGTCGCC
TGTATGCTACCGCTCTTCTTCTCCGCCAACCTCTTCTACAGCTATCAACAGAACAGCGTCAACGGCGACACCTTC
AATATTCACACGCGCTCCCTCAACGGCGCCTTCTACTGGCTGTCGCAAATGGTAGGCGGTCTGTTCATCGGCCTA
GTGCTCGACCTGTCGTGTCTCGGGCGGCGCGGCCGTGCTCGTCTCGGCTGGTCCATCGCCTTCGTTCTCGGTCTC
GTCATCTGGGGAGGAGGATATAAGTTCCAAGTCTGGCAGAACGAGCGCCTCGCCCGCAACCAGCGCCAGGACGTC
GACTTCAGGGACAGCGCCTTGGCCGCCGGACCGATGGCACTGTACGCATTCTACGGCGCCTACGATGCTCTCTGG
CAGGCCTTTGCCTACTGGCTCATCGGTACCGAGTCCAACAGTCCAGCCCGGGCCGCCATCCTCGTCGGCGCCTAC
AAGGGCCTACAGGCCGCAGGCGGCAGCATCGCCTGGCGCGTCAACGCCACCGGCGTGAGCCCCATGACCGAGTTG
GCCATGAACTGGGGGCTTTGCATAGGCTCTCTGCTTGTTGTCCTTCCCGTCGTCTGGACCGTTTCCGCCAGCACA
GGGGACGAGAAGGACGAGAGCGAAAAGGGGATGAACTCCAAGGAGGAAACGGGGGTT
Transcript >Ophio5|5935
ATGACGGCGGCAGGGCATCACGATAGGCCCAAGAGGCCCGCGTCCATGGTCAAAGACATGCAGACGGAGACGATT
CAGAATGTCGAGATTCGCGACGGTGCTCAGCTCGAGCTGGGCGGCAATGCCAAATCGACTTTGATCCGGCTCTAT
GGTCACCCTTGGACCCAGATTCTACTTATTAGCTTGATCTGCTTCTGTCTTCCTGGCATGTACAACGCTCTAGCC
GGCCTCGGAGGCTGCGGCCAAGTCGACTCAGCCGTAGCAGCCAACGCGACGGTAGCCATGCTCTCGACCATGGCC
ATCACCTCGCTCTTCATCGCCGGCCCGCTCTTCGCCTGGGCCGGCCCGCGCATCAGTCTCATGGCCGGCGGCTGG
ACGTACGCGCTCTACAGCGGCAGCCTGCTTAACTTCAACCGGACCGGAAACGGCGCGCTGGTCATCGCCTCGGGC
GCCATCCTCGGCGTCGGCGCCTCGCTGTTGTGGATCGTTCAGGGGGCCATCATGACGGCCTACGTCGACGAGTCT
CGCAAGGGTCGTGCCATTGCCATCTTCTGGGTCGTCTTCAACCTCGGCGGCGGCATCGGCTCGCTCGCCTCCTTT
GGACTCAACTATAACTCGGCCAAGGGTTCCGTCTCTAGCGCGACGTACGTCGCCCTCATGATCGTCATGCTCTTT
GGCTGGTCCCTCGGCCTATTGCTGTGCTCACCCTCGCGCGTCCGTGGAGCGGCACCGGCACCGAAGTCAGTCTCG
TCTCGGCCCCGACGCCGGATCATCATCGACGCCGCAAGGACATTGGTCCACGTTCTCTGCACCCGACGCGTCGCC
TGTATGCTACCGCTCTTCTTCTCCGCCAACCTCTTCTACAGCTATCAACAGAACAGCGTCAACGGCGACACCTTC
AATATTCACACGCGCTCCCTCAACGGCGCCTTCTACTGGCTGTCGCAAATGGTAGGCGGTCTGTTCATCGGCCTA
GTGCTCGACCTGTCGTGTCTCGGGCGGCGCGGCCGTGCTCGTCTCGGCTGGTCCATCGCCTTCGTTCTCGGTCTC
GTCATCTGGGGAGGAGGATATAAGTTCCAAGTCTGGCAGAACGAGCGCCTCGCCCGCAACCAGCGCCAGGACGTC
GACTTCAGGGACAGCGCCTTGGCCGCCGGACCGATGGCACTGTACGCATTCTACGGCGCCTACGATGCTCTCTGG
CAGGCCTTTGCCTACTGGCTCATCGGTACCGAGTCCAACAGTCCAGCCCGGGCCGCCATCCTCGTCGGCGCCTAC
AAGGGCCTACAGGCCGCAGGCGGCAGCATCGCCTGGCGCGTCAACGCCACCGGCGTGAGCCCCATGACCGAGTTG
GCCATGAACTGGGGGCTTTGCATAGGCTCTCTGCTTGTTGTCCTTCCCGTCGTCTGGACCGTTTCCGCCAGCACA
GGGGACGAGAAGGACGAGAGCGAAAAGGGGATGAACTCCAAGGAGGAAACGGGGGTTTGA
Gene >Ophio5|5935
ATGACGGCGGCAGGGCATCACGATAGGCCCAAGAGGCCCGCGTCCATGGTCAAAGACATGCAGACGGAGACGATT
CAGAATGTCGAGATTCGCGACGGTGCTCAGCTCGAGCTGGGCGGCAATGCCAAATCGACTTTGATCCGGCTCTAT
GGTCACCCTTGGACCCAGATTCTACTTATTAGCTTGATCTGCTTCTGTCTTCCTGGCGTACGTCTCCTCCCCCTT
CTGCTCTCGGCTTTCGATGAGTATGACTTCTTTCATTTTGATTTTTTTTCTCGTCTTCTTCTCCCCACTATCCCC
CTTCCCCCCTCCCCCCCCCTTTTTTATACCTCAGCTCGACCCCTTTCCACCGTCTTCTCAAAAATCTGACATGTG
CATTGCATCTCCGCAGATGTACAACGCTCTAGCCGGCCTCGGAGGCTGCGGCCAAGTCGACTCAGCCGTAGCAGC
CAACGCGACGGTAGCCATGCTCTCGACCATGGCCATCACCTCGCTCTTCATCGCCGGCCCGCTCTTCGCCTGGGC
CGGCCCGCGCATCAGTCTCATGGCCGGCGGCTGGACGTACGCGCTCTACAGCGGCAGCCTGCTTAACTTCAACCG
GACCGGAAACGGCGCGCTGGTCATCGCCTCGGGCGCCATCCTCGGCGTCGGCGCCTCGCTGTTGTGGATCGTTCA
GGGGGCCATCATGACGGCCTACGTCGACGAGTCTCGCAAGGGTCGTGCCATTGCCATCTTCTGGGTCGTCTTCAA
CCTCGGCGGCGGCATCGGCTCGCTCGCCTCCTTTGGACTCAACTATAACTCGGCCAAGGGTTCCGTCTCTAGCGC
GACGTACGTCGCCCTCATGATCGTCATGCTCTTTGGCTGGTCCCTCGGCCTATTGCTGTGCTCACCCTCGCGCGT
CCGTGGAGCGGCACCGGCACCGAAGTCAGTCTCGTCTCGGCCCCGACGCCGGATCATCATCGACGCCGCAAGGAC
ATTGGTCCACGTTCTCTGCACCCGACGCGTCGCCTGTATGCTACCGCTCTTCTTCTCCGCCAACCTCTTCTACAG
CTATCAACAGAACAGCGTCAACGGCGACACCTTCAATATTCACACGCGCTCCCTCAACGGCGCCTTCTACTGGCT
GTCGCAAATGGTAGGCGGTCTGTTCATCGGCCTAGTGCTCGACCTGTCGTGTCTCGGGCGGCGCGGCCGTGCTCG
TCTCGGCTGGTCCATCGCCTTCGTTCTCGGTCTCGTCATCTGGGGAGGAGGATATAAGTTCCAAGTCTGGCAGAA
CGAGCGCCTCGCCCGCAACCAGCGCCAGGACGTCGACTTCAGGGACAGCGCCTTGGCCGCCGGACCGATGGCACT
GTACGCATTCTACGGCGCCTACGATGCTCTCTGGCAGGCCTTTGCCTACTGGCTCATCGGTACCGAGTCCAACAG
TCCAGCCCGGGCCGCCATCCTCGTCGGCGCCTACAAGGGCCTACAGGCCGCAGGCGGCAGCATCGCCTGGCGCGT
CAACGCCACCGGCGTGAGCCCCATGACCGAGTTGGCCATGAACTGGGGGCTTTGCATAGGCTCTCTGCTTGTTGT
CCTTCCCGTCGTCTGGACCGTTTCCGCCAGCACAGGGGACGAGAAGGACGAGAGCGAAAAGGGGATGAACTCCAA
GGAGGAAACGGGGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail