Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5932
Gene name
Locationscaffold_5:94159..95077
Strand+
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01391 Collagen Collagen triple helix repeat (20 copies) 1.0E-07 80 134
PF01391 Collagen Collagen triple helix repeat (20 copies) 9.1E-10 103 161
PF01391 Collagen Collagen triple helix repeat (20 copies) 2.8E-09 190 247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 78 244 8.0E-22
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 80 286 8.0E-22
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 5 248 1.0E-21
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 78 244 7.0E-21
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 75 246 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 78 244 8.0E-22
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 80 286 8.0E-22
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 5 248 1.0E-21
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 78 244 7.0E-21
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 75 246 1.0E-20
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 79 244 2.0E-19
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 78 244 3.0E-19
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 79 294 4.0E-19
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 78 245 2.0E-18
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 80 241 2.0E-18
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 80 251 3.0E-18
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 80 244 3.0E-18
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 79 241 3.0E-18
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 80 244 4.0E-18
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 78 238 5.0E-18
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 78 246 5.0E-18
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 79 244 5.0E-18
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 74 251 6.0E-18
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 79 245 7.0E-18
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 79 244 8.0E-18
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 78 246 1.0E-17
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 78 235 1.0E-17
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 80 244 1.0E-17
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 79 241 1.0E-17
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 80 244 1.0E-17
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 78 249 2.0E-17
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 79 249 3.0E-17
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 80 244 4.0E-17
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 79 248 5.0E-17
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 78 252 5.0E-17
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 67 248 5.0E-17
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 78 246 6.0E-17
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 79 249 7.0E-17
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 62 216 7.0E-17
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 79 244 8.0E-17
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 83 232 8.0E-17
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 80 241 9.0E-17
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 80 244 9.0E-17
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 80 246 1.0E-16
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 78 232 1.0E-16
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 82 244 1.0E-16
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 80 248 1.0E-16
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 92 251 1.0E-16
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 79 246 2.0E-16
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 78 251 2.0E-16
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 80 241 2.0E-16
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 80 244 3.0E-16
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 74 251 3.0E-16
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 80 245 3.0E-16
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 80 248 3.0E-16
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 80 255 3.0E-16
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 80 246 4.0E-16
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 79 244 4.0E-16
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 79 238 5.0E-16
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 86 244 5.0E-16
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 46 246 6.0E-16
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 78 244 6.0E-16
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 79 230 9.0E-16
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 79 244 1.0E-15
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 82 246 1.0E-15
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 102 244 1.0E-15
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 93 241 1.0E-15
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 80 244 1.0E-15
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 79 245 1.0E-15
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 78 245 2.0E-15
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 78 249 2.0E-15
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 79 251 2.0E-15
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 80 244 2.0E-15
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 80 264 2.0E-15
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 79 244 3.0E-15
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 79 244 3.0E-15
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 80 244 3.0E-15
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 102 244 3.0E-15
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 79 244 3.0E-15
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 78 249 3.0E-15
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 80 249 4.0E-15
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 88 249 4.0E-15
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 78 239 4.0E-15
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 78 244 5.0E-15
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 88 246 5.0E-15
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 80 246 5.0E-15
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 80 245 5.0E-15
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 79 294 5.0E-15
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 79 246 6.0E-15
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 79 245 6.0E-15
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 79 242 6.0E-15
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 80 244 7.0E-15
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 89 246 7.0E-15
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 79 235 7.0E-15
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 80 249 8.0E-15
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 102 232 8.0E-15
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 80 246 9.0E-15
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 79 238 9.0E-15
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 80 247 1.0E-14
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 79 244 1.0E-14
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 79 246 1.0E-14
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 79 235 1.0E-14
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 106 246 1.0E-14
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 80 244 1.0E-14
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 78 246 1.0E-14
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 80 244 1.0E-14
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 79 244 2.0E-14
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 80 234 2.0E-14
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 127 244 2.0E-14
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 80 245 2.0E-14
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 78 246 2.0E-14
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 83 244 2.0E-14
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 84 244 2.0E-14
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 79 241 2.0E-14
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 92 246 2.0E-14
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 15 245 2.0E-14
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 80 251 3.0E-14
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 86 241 3.0E-14
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 80 233 3.0E-14
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 79 246 3.0E-14
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 78 220 3.0E-14
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 79 248 3.0E-14
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 91 246 3.0E-14
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 80 244 3.0E-14
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 79 244 3.0E-14
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 78 246 3.0E-14
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 103 249 3.0E-14
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 80 244 4.0E-14
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 79 244 4.0E-14
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 80 262 5.0E-14
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 78 246 5.0E-14
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 102 241 5.0E-14
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 79 239 5.0E-14
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 80 228 5.0E-14
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 78 245 6.0E-14
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 83 245 6.0E-14
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 80 244 6.0E-14
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 80 246 7.0E-14
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 80 245 7.0E-14
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 79 244 7.0E-14
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 78 246 7.0E-14
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 101 244 7.0E-14
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 79 251 8.0E-14
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 78 238 8.0E-14
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 80 246 8.0E-14
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 79 223 9.0E-14
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 82 249 9.0E-14
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 79 244 9.0E-14
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 80 244 9.0E-14
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 80 249 9.0E-14
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 79 244 9.0E-14
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 78 245 1.0E-13
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 116 246 1.0E-13
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 79 235 1.0E-13
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 79 227 1.0E-13
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 88 245 1.0E-13
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 78 244 1.0E-13
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 80 249 1.0E-13
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 83 259 1.0E-13
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 82 236 1.0E-13
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 76 249 2.0E-13
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 80 254 2.0E-13
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 78 244 2.0E-13
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 80 235 2.0E-13
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 79 244 2.0E-13
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 89 213 2.0E-13
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 80 244 2.0E-13
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 88 245 2.0E-13
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 80 249 2.0E-13
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 79 247 3.0E-13
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 80 246 3.0E-13
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 95 249 3.0E-13
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 79 244 3.0E-13
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 79 232 3.0E-13
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 80 244 3.0E-13
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 79 244 3.0E-13
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 78 245 3.0E-13
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 83 244 3.0E-13
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 83 238 3.0E-13
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 80 244 4.0E-13
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 102 245 4.0E-13
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 80 244 4.0E-13
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 79 244 4.0E-13
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 86 244 4.0E-13
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 80 225 5.0E-13
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 83 249 5.0E-13
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 79 246 5.0E-13
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 79 239 5.0E-13
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 79 246 5.0E-13
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 80 244 5.0E-13
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 98 244 5.0E-13
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 109 245 6.0E-13
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 80 225 6.0E-13
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 103 249 6.0E-13
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 78 217 6.0E-13
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 79 228 6.0E-13
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 80 246 6.0E-13
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 88 245 7.0E-13
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 83 246 7.0E-13
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 78 246 7.0E-13
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 80 244 8.0E-13
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 112 244 8.0E-13
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 80 244 8.0E-13
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 90 246 8.0E-13
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 83 244 9.0E-13
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 80 245 9.0E-13
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 88 248 9.0E-13
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 79 232 1.0E-12
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 80 245 1.0E-12
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 78 244 1.0E-12
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 82 244 1.0E-12
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 76 246 1.0E-12
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 79 244 1.0E-12
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 80 234 1.0E-12
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 116 241 1.0E-12
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 80 244 1.0E-12
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 80 249 1.0E-12
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 80 249 1.0E-12
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 71 244 1.0E-12
sp|P12109|CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3 80 246 1.0E-12
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 79 251 1.0E-12
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 44 241 1.0E-12
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 80 246 1.0E-12
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 80 244 1.0E-12
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 75 238 1.0E-12
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 80 246 2.0E-12
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 80 234 2.0E-12
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 88 244 2.0E-12
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 78 232 2.0E-12
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 80 244 2.0E-12
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 80 218 2.0E-12
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 79 244 2.0E-12
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 78 244 2.0E-12
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 79 251 2.0E-12
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 80 247 2.0E-12
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 83 246 2.0E-12
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 88 246 2.0E-12
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 78 212 2.0E-12
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 80 245 2.0E-12
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 78 244 2.0E-12
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 80 249 2.0E-12
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 80 248 2.0E-12
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 80 249 2.0E-12
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 73 246 2.0E-12
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 83 272 2.0E-12
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 80 267 2.0E-12
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 78 221 3.0E-12
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 102 246 3.0E-12
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 75 244 3.0E-12
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 106 244 3.0E-12
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 80 239 3.0E-12
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 79 249 3.0E-12
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 75 249 3.0E-12
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 102 241 3.0E-12
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 86 238 3.0E-12
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 112 238 4.0E-12
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 83 246 4.0E-12
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 89 244 4.0E-12
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 80 249 4.0E-12
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 80 234 4.0E-12
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 46 244 4.0E-12
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 80 241 4.0E-12
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 94 244 4.0E-12
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 79 241 4.0E-12
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 1 251 4.0E-12
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 79 244 4.0E-12
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 78 244 5.0E-12
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 78 235 5.0E-12
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 75 220 5.0E-12
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 80 244 5.0E-12
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 80 246 5.0E-12
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 78 249 5.0E-12
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 83 249 5.0E-12
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 80 246 5.0E-12
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 92 244 6.0E-12
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 80 245 6.0E-12
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 83 246 6.0E-12
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 80 246 6.0E-12
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 80 245 7.0E-12
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 80 246 7.0E-12
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 80 244 8.0E-12
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 83 246 8.0E-12
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 79 244 1.0E-11
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 78 245 1.0E-11
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 78 244 1.0E-11
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 21 246 1.0E-11
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 79 246 1.0E-11
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 83 249 1.0E-11
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 82 244 1.0E-11
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 80 244 1.0E-11
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 80 244 1.0E-11
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 79 245 1.0E-11
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 80 244 1.0E-11
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 80 244 1.0E-11
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 79 244 1.0E-11
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 44 223 1.0E-11
sp|C0HJP4|CO1A2_MYLDA Collagen alpha-2(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A2 PE=1 SV=1 53 251 1.0E-11
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 83 245 1.0E-11
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 78 249 2.0E-11
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 103 244 2.0E-11
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 78 238 2.0E-11
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 75 238 2.0E-11
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 79 244 2.0E-11
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 109 241 2.0E-11
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 79 217 2.0E-11
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 80 244 2.0E-11
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 78 244 2.0E-11
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 88 246 2.0E-11
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 88 244 2.0E-11
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 93 238 3.0E-11
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 3 255 3.0E-11
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 89 244 3.0E-11
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 80 246 3.0E-11
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 80 244 3.0E-11
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 104 246 3.0E-11
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 80 247 3.0E-11
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 80 244 4.0E-11
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 80 226 4.0E-11
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 74 231 4.0E-11
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 115 244 4.0E-11
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 79 244 4.0E-11
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 79 202 5.0E-11
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 70 249 5.0E-11
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 91 244 5.0E-11
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 82 246 5.0E-11
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 80 230 5.0E-11
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 83 235 5.0E-11
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 79 246 5.0E-11
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 79 238 5.0E-11
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 44 244 5.0E-11
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 72 244 6.0E-11
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 79 244 6.0E-11
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 83 247 6.0E-11
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 91 225 6.0E-11
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 80 244 6.0E-11
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 79 244 6.0E-11
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 80 246 6.0E-11
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 80 244 6.0E-11
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 80 267 6.0E-11
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 80 242 6.0E-11
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 80 251 6.0E-11
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 78 214 6.0E-11
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 78 228 7.0E-11
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 80 217 7.0E-11
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 102 245 7.0E-11
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 82 244 7.0E-11
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 80 249 7.0E-11
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 85 244 8.0E-11
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 79 246 8.0E-11
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 80 227 8.0E-11
sp|P50404|SFTPD_MOUSE Pulmonary surfactant-associated protein D OS=Mus musculus GN=Sftpd PE=1 SV=1 127 244 8.0E-11
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 79 249 9.0E-11
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 80 245 9.0E-11
sp|C0HJP4|CO1A2_MYLDA Collagen alpha-2(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A2 PE=1 SV=1 78 246 9.0E-11
sp|Q8MHZ9|CL46_BOVIN Collectin-46 OS=Bos taurus GN=CL46 PE=2 SV=1 83 269 9.0E-11
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 80 217 1.0E-10
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 80 244 1.0E-10
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 80 249 1.0E-10
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 80 216 1.0E-10
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 80 249 1.0E-10
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 80 241 1.0E-10
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 78 224 1.0E-10
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 80 221 1.0E-10
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 80 263 1.0E-10
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 79 217 1.0E-10
sp|P25318|CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus GN=Col8a2 PE=2 SV=2 78 238 1.0E-10
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 83 253 1.0E-10
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 106 233 1.0E-10
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 79 246 1.0E-10
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 89 246 2.0E-10
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 79 257 2.0E-10
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 79 202 2.0E-10
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 78 251 2.0E-10
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 78 223 2.0E-10
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 80 246 2.0E-10
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 80 244 2.0E-10
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 80 246 2.0E-10
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 80 249 2.0E-10
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 80 244 2.0E-10
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 80 251 2.0E-10
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 80 246 2.0E-10
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 80 244 2.0E-10
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 80 229 2.0E-10
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 79 234 2.0E-10
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 79 249 2.0E-10
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 81 244 2.0E-10
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 88 244 2.0E-10
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 92 244 2.0E-10
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 84 242 2.0E-10
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 112 246 2.0E-10
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 72 245 2.0E-10
sp|B7Z0K8|COLL1_DROME Collagen alpha chain CG42342 OS=Drosophila melanogaster GN=CG42342 PE=2 SV=1 83 212 2.0E-10
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 82 245 3.0E-10
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 79 249 3.0E-10
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 80 244 3.0E-10
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 80 246 3.0E-10
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 80 249 3.0E-10
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 92 245 3.0E-10
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 80 244 3.0E-10
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 102 245 3.0E-10
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 80 246 3.0E-10
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 83 244 3.0E-10
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 83 234 3.0E-10
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 79 244 4.0E-10
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 80 246 4.0E-10
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 78 246 4.0E-10
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 79 246 4.0E-10
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 92 231 4.0E-10
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 114 244 4.0E-10
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 79 232 4.0E-10
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 78 244 4.0E-10
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 79 217 4.0E-10
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 80 264 5.0E-10
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 124 246 5.0E-10
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 91 244 5.0E-10
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 76 251 5.0E-10
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 80 244 5.0E-10
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 80 245 6.0E-10
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 86 245 6.0E-10
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 80 244 6.0E-10
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 73 245 6.0E-10
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 79 245 6.0E-10
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 79 218 7.0E-10
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 94 238 7.0E-10
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 80 244 7.0E-10
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 80 244 7.0E-10
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 79 244 7.0E-10
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 78 244 7.0E-10
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 80 208 7.0E-10
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 80 251 7.0E-10
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 78 193 7.0E-10
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 79 245 7.0E-10
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 103 245 8.0E-10
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 88 246 8.0E-10
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 79 244 8.0E-10
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 79 249 8.0E-10
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 80 245 8.0E-10
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 80 249 8.0E-10
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 48 241 8.0E-10
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 78 241 8.0E-10
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 92 246 8.0E-10
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 78 193 8.0E-10
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 102 243 8.0E-10
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 80 246 9.0E-10
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 92 246 9.0E-10
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 78 246 1.0E-09
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 118 249 1.0E-09
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 80 230 1.0E-09
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 79 246 1.0E-09
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 79 202 1.0E-09
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 95 244 1.0E-09
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 79 248 1.0E-09
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 79 242 1.0E-09
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 74 249 1.0E-09
sp|C0HJP4|CO1A2_MYLDA Collagen alpha-2(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A2 PE=1 SV=1 80 245 1.0E-09
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 98 246 1.0E-09
sp|P25318|CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus GN=Col8a2 PE=2 SV=2 92 245 1.0E-09
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 83 234 1.0E-09
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 67 245 1.0E-09
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 83 217 1.0E-09
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 79 245 1.0E-09
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 78 193 1.0E-09
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 92 246 1.0E-09
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 83 269 1.0E-09
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 92 245 1.0E-09
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 94 238 2.0E-09
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 91 248 2.0E-09
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 90 246 2.0E-09
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 72 246 2.0E-09
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 80 198 2.0E-09
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 115 246 2.0E-09
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 78 246 2.0E-09
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 80 230 2.0E-09
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 112 244 2.0E-09
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 90 244 2.0E-09
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 80 244 2.0E-09
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 80 250 2.0E-09
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 80 238 2.0E-09
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 78 249 2.0E-09
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 112 249 2.0E-09
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 112 249 2.0E-09
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 120 232 2.0E-09
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 85 246 2.0E-09
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 93 244 2.0E-09
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 102 245 2.0E-09
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 112 249 2.0E-09
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 79 222 2.0E-09
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 102 244 2.0E-09
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 80 244 2.0E-09
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 90 249 3.0E-09
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 79 249 3.0E-09
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 98 244 3.0E-09
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 79 241 3.0E-09
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 78 244 3.0E-09
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 80 244 3.0E-09
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 80 235 3.0E-09
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 80 223 3.0E-09
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 80 244 3.0E-09
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 80 247 3.0E-09
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 85 239 3.0E-09
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 80 238 3.0E-09
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 80 238 3.0E-09
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 80 249 4.0E-09
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 80 244 4.0E-09
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 80 220 4.0E-09
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 80 252 4.0E-09
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 80 252 4.0E-09
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 74 244 4.0E-09
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 88 241 4.0E-09
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 79 248 4.0E-09
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 80 238 4.0E-09
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 79 245 4.0E-09
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 80 241 4.0E-09
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 78 244 4.0E-09
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 92 246 5.0E-09
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 80 267 5.0E-09
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 80 172 5.0E-09
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 80 226 5.0E-09
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 80 244 6.0E-09
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 109 244 6.0E-09
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 130 248 6.0E-09
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 102 244 6.0E-09
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 102 244 6.0E-09
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 78 245 6.0E-09
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 79 244 7.0E-09
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 80 245 7.0E-09
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 142 246 7.0E-09
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 89 211 8.0E-09
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 102 244 8.0E-09
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 79 245 8.0E-09
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 80 244 8.0E-09
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 123 244 8.0E-09
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 80 244 8.0E-09
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 118 249 8.0E-09
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 78 246 8.0E-09
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 79 246 8.0E-09
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 80 223 8.0E-09
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 79 244 9.0E-09
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 79 248 9.0E-09
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 80 246 9.0E-09
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 80 230 9.0E-09
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 102 244 9.0E-09
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 56 245 9.0E-09
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 80 248 9.0E-09
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 80 211 9.0E-09
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 94 246 1.0E-08
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 80 230 1.0E-08
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 80 233 1.0E-08
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 80 232 1.0E-08
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 92 231 1.0E-08
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 92 241 1.0E-08
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 94 220 1.0E-08
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 102 244 1.0E-08
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 124 245 1.0E-08
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 80 245 1.0E-08
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 102 245 1.0E-08
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 80 246 1.0E-08
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 94 230 1.0E-08
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 58 248 1.0E-08
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 80 223 1.0E-08
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 90 246 1.0E-08
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 78 233 1.0E-08
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 83 246 1.0E-08
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 78 245 1.0E-08
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 78 244 1.0E-08
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 102 244 1.0E-08
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 132 247 1.0E-08
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 116 246 1.0E-08
sp|C0HJP7|CO1A1_TOXSP Collagen alpha-1(I) chain (Fragments) OS=Toxodon sp. GN=COL1A1 PE=1 SV=1 80 249 1.0E-08
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 80 246 2.0E-08
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 79 248 2.0E-08
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 80 216 2.0E-08
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 80 206 2.0E-08
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 79 244 2.0E-08
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 80 244 2.0E-08
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 79 225 2.0E-08
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 78 238 2.0E-08
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 80 248 2.0E-08
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 94 220 2.0E-08
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 78 238 2.0E-08
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 80 242 2.0E-08
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 70 233 2.0E-08
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 80 244 2.0E-08
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 94 233 2.0E-08
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 78 233 2.0E-08
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 94 230 2.0E-08
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 80 230 2.0E-08
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 83 234 2.0E-08
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 80 170 2.0E-08
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 78 248 2.0E-08
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 113 239 2.0E-08
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 78 244 2.0E-08
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 80 241 2.0E-08
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 112 245 3.0E-08
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 80 254 3.0E-08
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 79 229 3.0E-08
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 144 246 3.0E-08
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 79 231 3.0E-08
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 78 249 3.0E-08
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 98 230 3.0E-08
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 79 245 3.0E-08
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 78 249 3.0E-08
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 80 244 3.0E-08
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 76 245 3.0E-08
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 80 249 3.0E-08
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 80 249 3.0E-08
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 79 246 3.0E-08
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 102 244 3.0E-08
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 80 233 3.0E-08
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 102 245 3.0E-08
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 102 243 3.0E-08
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 79 244 3.0E-08
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 86 249 4.0E-08
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 80 241 4.0E-08
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 79 245 4.0E-08
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 87 251 4.0E-08
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 80 248 4.0E-08
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 79 244 5.0E-08
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 78 245 5.0E-08
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 124 246 5.0E-08
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 112 244 5.0E-08
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 106 224 5.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 79 244 5.0E-08
sp|C0HJP1|CO1A1_CYCDI Collagen alpha-1(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A1 PE=1 SV=1 120 251 5.0E-08
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 78 245 6.0E-08
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 92 232 6.0E-08
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 80 233 6.0E-08
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 80 217 6.0E-08
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 94 246 6.0E-08
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 78 211 6.0E-08
sp|Q9R1N9|CODA1_MOUSE Collagen alpha-1(XIII) chain OS=Mus musculus GN=Col13a1 PE=2 SV=1 78 242 6.0E-08
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 74 235 6.0E-08
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 78 244 7.0E-08
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 83 240 7.0E-08
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 95 234 7.0E-08
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 90 241 7.0E-08
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 77 223 7.0E-08
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 86 249 8.0E-08
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 79 246 8.0E-08
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 112 244 8.0E-08
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 80 262 8.0E-08
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 83 234 8.0E-08
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 82 238 8.0E-08
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 80 218 8.0E-08
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 80 255 8.0E-08
sp|Q9UMD9|COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens GN=COL17A1 PE=1 SV=3 79 245 8.0E-08
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 111 248 9.0E-08
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 80 244 9.0E-08
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 80 249 9.0E-08
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 80 220 9.0E-08
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 80 223 9.0E-08
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 78 245 1.0E-07
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 78 249 1.0E-07
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 111 245 1.0E-07
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 78 230 1.0E-07
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 79 241 1.0E-07
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 92 232 1.0E-07
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 80 249 1.0E-07
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 78 249 1.0E-07
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 118 223 1.0E-07
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 94 249 1.0E-07
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 83 217 1.0E-07
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 79 241 1.0E-07
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 83 241 1.0E-07
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 80 234 1.0E-07
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 79 244 1.0E-07
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 106 246 1.0E-07
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 98 244 1.0E-07
sp|A8XV37|CO145_CAEBR Putative cuticle collagen 145 OS=Caenorhabditis briggsae GN=col-145 PE=3 SV=1 83 180 1.0E-07
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 82 244 1.0E-07
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 79 255 1.0E-07
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 79 220 1.0E-07
sp|C0HJN5|CO1A1_HIPAM Collagen alpha-1(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A1 PE=1 SV=1 102 241 1.0E-07
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 103 246 2.0E-07
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 80 219 2.0E-07
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 106 244 2.0E-07
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 79 229 2.0E-07
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 89 235 2.0E-07
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 111 246 2.0E-07
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 80 215 2.0E-07
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 90 245 2.0E-07
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 80 249 2.0E-07
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 82 245 2.0E-07
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 80 244 2.0E-07
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 79 245 2.0E-07
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 79 244 2.0E-07
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 80 224 2.0E-07
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 78 245 2.0E-07
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 80 199 2.0E-07
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 78 194 2.0E-07
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 78 194 2.0E-07
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 80 245 2.0E-07
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 78 194 2.0E-07
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 97 216 2.0E-07
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 95 244 2.0E-07
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 80 246 2.0E-07
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 120 241 2.0E-07
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 119 244 2.0E-07
sp|A5PMY6|COL12_DANRE Collectin-12 OS=Danio rerio GN=colec12 PE=2 SV=1 106 211 2.0E-07
sp|Q9N1X4|SFTPD_PIG Pulmonary surfactant-associated protein D OS=Sus scrofa GN=SFTPD PE=1 SV=1 83 286 2.0E-07
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 79 244 3.0E-07
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 80 215 3.0E-07
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 79 235 3.0E-07
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 80 202 3.0E-07
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 86 249 3.0E-07
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 133 246 3.0E-07
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 80 246 3.0E-07
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 80 224 3.0E-07
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 104 244 3.0E-07
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 87 244 3.0E-07
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 115 241 3.0E-07
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 120 241 3.0E-07
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 95 230 3.0E-07
sp|Q5UPS6|COLL5_MIMIV Collagen-like protein 5 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R241 PE=4 SV=1 80 248 3.0E-07
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 80 190 4.0E-07
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 80 215 4.0E-07
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 75 252 4.0E-07
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 102 221 4.0E-07
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 124 246 4.0E-07
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 80 199 4.0E-07
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 78 244 4.0E-07
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 79 181 4.0E-07
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 112 251 4.0E-07
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 114 244 4.0E-07
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 123 241 4.0E-07
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 94 223 4.0E-07
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 80 248 5.0E-07
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 113 244 5.0E-07
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 106 246 5.0E-07
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 80 252 5.0E-07
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 78 221 5.0E-07
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 82 223 5.0E-07
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 92 235 5.0E-07
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 80 190 5.0E-07
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 124 251 5.0E-07
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 78 249 5.0E-07
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 78 190 5.0E-07
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 122 244 6.0E-07
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 80 224 6.0E-07
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 130 244 6.0E-07
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 94 223 6.0E-07
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 78 190 6.0E-07
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 35 241 7.0E-07
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 78 245 7.0E-07
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 79 235 7.0E-07
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 89 244 7.0E-07
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 114 246 7.0E-07
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 80 249 7.0E-07
sp|C0HJP2|CO1A2_CYCDI Collagen alpha-2(I) chain (Fragments) OS=Cyclopes didactylus GN=COL1A2 PE=1 SV=1 79 244 7.0E-07
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 79 244 7.0E-07
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 94 223 7.0E-07
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 139 254 8.0E-07
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 80 228 8.0E-07
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 80 248 8.0E-07
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 116 245 8.0E-07
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 102 244 8.0E-07
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 80 216 9.0E-07
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 101 244 9.0E-07
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 78 245 9.0E-07
sp|Q8K299|SCAR5_MOUSE Scavenger receptor class A member 5 OS=Mus musculus GN=Scara5 PE=1 SV=1 174 245 9.0E-07
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 95 244 1.0E-06
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 80 244 1.0E-06
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 92 230 1.0E-06
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 103 244 1.0E-06
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 78 245 1.0E-06
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 82 245 1.0E-06
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 45 244 1.0E-06
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 88 241 1.0E-06
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 80 244 1.0E-06
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 107 225 1.0E-06
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 120 244 1.0E-06
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 80 244 1.0E-06
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 66 181 1.0E-06
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 80 246 1.0E-06
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 97 208 1.0E-06
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 112 246 1.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 80 226 1.0E-06
sp|Q6ZMJ2|SCAR5_HUMAN Scavenger receptor class A member 5 OS=Homo sapiens GN=SCARA5 PE=2 SV=1 174 244 1.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 50 165 1.0E-06
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 90 238 1.0E-06
sp|P31722|C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus GN=C1qc PE=1 SV=2 159 229 1.0E-06
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 92 246 1.0E-06
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 80 221 2.0E-06
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 92 230 2.0E-06
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 80 248 2.0E-06
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 102 246 2.0E-06
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 79 230 2.0E-06
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 80 244 2.0E-06
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 91 224 2.0E-06
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 83 246 2.0E-06
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 130 256 2.0E-06
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 103 248 2.0E-06
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 79 246 2.0E-06
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 103 249 2.0E-06
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 80 202 2.0E-06
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 123 246 2.0E-06
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 80 228 2.0E-06
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 106 193 2.0E-06
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 104 244 2.0E-06
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 80 216 2.0E-06
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 115 246 2.0E-06
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 80 232 2.0E-06
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 75 208 2.0E-06
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 1 245 2.0E-06
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 114 244 2.0E-06
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 79 238 2.0E-06
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 80 235 2.0E-06
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 83 232 2.0E-06
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 78 196 2.0E-06
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 94 234 2.0E-06
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 108 214 2.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 87 189 2.0E-06
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 85 215 2.0E-06
sp|Q07563|COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus GN=Col17a1 PE=1 SV=3 88 223 2.0E-06
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 98 235 2.0E-06
sp|Q02105|C1QC_MOUSE Complement C1q subcomponent subunit C OS=Mus musculus GN=C1qc PE=1 SV=2 159 229 2.0E-06
sp|Q810Y4|CONA1_RAT Collagen alpha-1(XXIII) chain OS=Rattus norvegicus GN=Col23a1 PE=1 SV=1 83 225 2.0E-06
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 102 244 3.0E-06
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 88 245 3.0E-06
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 83 223 3.0E-06
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 78 245 3.0E-06
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 80 226 3.0E-06
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 92 178 3.0E-06
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 80 246 3.0E-06
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 80 244 3.0E-06
sp|Q5UQ13|COLL2_MIMIV Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R196 PE=4 SV=1 80 249 3.0E-06
sp|P50404|SFTPD_MOUSE Pulmonary surfactant-associated protein D OS=Mus musculus GN=Sftpd PE=1 SV=1 80 274 3.0E-06
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 89 196 3.0E-06
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 83 217 3.0E-06
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 97 234 3.0E-06
sp|Q5UPS6|COLL5_MIMIV Collagen-like protein 5 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R241 PE=4 SV=1 89 244 3.0E-06
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 95 230 3.0E-06
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 80 235 3.0E-06
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 92 224 3.0E-06
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 87 224 3.0E-06
sp|Q8K4G2|CONA1_MOUSE Collagen alpha-1(XXIII) chain OS=Mus musculus GN=Col23a1 PE=2 SV=2 83 225 3.0E-06
sp|C0HJN7|CO1A1_TAPTE Collagen alpha-1(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A1 PE=1 SV=1 80 224 3.0E-06
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 92 244 4.0E-06
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 78 228 4.0E-06
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 80 208 4.0E-06
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 103 262 4.0E-06
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 75 214 4.0E-06
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 89 245 4.0E-06
sp|Q5UQ50|COLL6_MIMIV Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L668 PE=4 SV=1 102 262 4.0E-06
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 94 225 4.0E-06
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 80 238 4.0E-06
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 82 231 4.0E-06
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 95 230 4.0E-06
sp|Q5UPS6|COLL5_MIMIV Collagen-like protein 5 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R241 PE=4 SV=1 104 249 4.0E-06
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 124 247 4.0E-06
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 160 245 5.0E-06
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 83 246 5.0E-06
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 80 211 5.0E-06
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 78 222 5.0E-06
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 79 238 5.0E-06
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 87 246 5.0E-06
sp|Q9UMD9|COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens GN=COL17A1 PE=1 SV=3 102 244 5.0E-06
sp|C0HJN7|CO1A1_TAPTE Collagen alpha-1(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A1 PE=1 SV=1 118 205 5.0E-06
sp|Q5RFW0|SCAR5_DANRE Scavenger receptor class A member 5 OS=Danio rerio GN=scara5 PE=3 SV=1 68 229 5.0E-06
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 80 230 6.0E-06
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 118 303 6.0E-06
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 125 249 6.0E-06
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 79 223 6.0E-06
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 79 184 6.0E-06
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 79 248 6.0E-06
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 103 238 6.0E-06
sp|C0HJP4|CO1A2_MYLDA Collagen alpha-2(I) chain (Fragments) OS=Mylodon darwinii GN=COL1A2 PE=1 SV=1 115 212 6.0E-06
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 87 248 6.0E-06
sp|C0HJP7|CO1A1_TOXSP Collagen alpha-1(I) chain (Fragments) OS=Toxodon sp. GN=COL1A1 PE=1 SV=1 93 251 6.0E-06
sp|C0HJP7|CO1A1_TOXSP Collagen alpha-1(I) chain (Fragments) OS=Toxodon sp. GN=COL1A1 PE=1 SV=1 118 205 6.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 102 231 6.0E-06
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 80 235 6.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 160 261 6.0E-06
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 79 245 7.0E-06
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 158 245 7.0E-06
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 87 244 7.0E-06
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 80 241 7.0E-06
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 80 235 7.0E-06
sp|Q6ZMJ2|SCAR5_HUMAN Scavenger receptor class A member 5 OS=Homo sapiens GN=SCARA5 PE=2 SV=1 70 181 7.0E-06
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 113 238 8.0E-06
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 80 246 8.0E-06
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 80 246 8.0E-06
sp|B7Z0K8|COLL1_DROME Collagen alpha chain CG42342 OS=Drosophila melanogaster GN=CG42342 PE=2 SV=1 94 242 8.0E-06
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 79 211 8.0E-06
sp|Q28083|COBA1_BOVIN Collagen alpha-1(XI) chain (Fragment) OS=Bos taurus GN=COL11A1 PE=1 SV=1 80 245 8.0E-06
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 79 202 9.0E-06
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 78 235 9.0E-06
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 102 246 9.0E-06
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 90 245 9.0E-06
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 127 244 9.0E-06
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 92 241 9.0E-06
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 130 221 9.0E-06
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 79 224 9.0E-06
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 158 245 1.0E-05
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 91 246 1.0E-05
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 80 245 1.0E-05
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 82 244 1.0E-05
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 80 245 1.0E-05
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 80 245 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5932
MRFETVATLVAFAGSCLAAPKVDAKNTATDKAGSYDDQGGDSYDSYQPAQDNYQQNNYAKPEYKQPEYKQTEYKT
EYKVGPPGPPGKNGYDGKQGPPGPPGKGYPGPPGPPGPVGPPGKNGYPGAPGKPGPPGKNGYPGPPGKNGYPGPP
GKNGYDGKQGPPGPVGPPGKNGYPGPPGKNGYDGKQGPPGPPGPPGPAGPPGPAGPPGPPGPPGKQGPPGKPGYD
GKNGYDGKQGPPGPPGPPGKSYEKTYEKPYEKSYGKTEYGSNNYGTPAYGGGASYGGSTDNYGGGNGNYGGGNGG
GGDGY
Coding >Ophio5|5932
ATGCGTTTCGAGACAGTTGCGACTTTGGTGGCCTTCGCGGGCAGCTGCCTGGCTGCCCCGAAGGTGGATGCCAAG
AACACGGCGACAGACAAGGCCGGCTCTTACGATGACCAGGGCGGCGATTCGTACGACAGCTATCAGCCGGCTCAG
GACAACTACCAGCAGAACAACTACGCCAAGCCCGAGTACAAGCAGCCCGAGTACAAGCAGACCGAGTACAAGACC
GAGTACAAGGTTGGTCCTCCGGGACCGCCCGGCAAGAACGGCTACGATGGGAAGCAGGGTCCTCCCGGCCCTCCC
GGTAAGGGCTACCCCGGCCCTCCCGGTCCACCTGGCCCTGTCGGCCCTCCGGGCAAGAACGGCTACCCTGGAGCG
CCGGGCAAACCCGGGCCCCCGGGCAAGAATGGTTATCCCGGTCCTCCTGGCAAGAATGGTTATCCCGGTCCTCCT
GGCAAGAACGGCTACGATGGGAAACAGGGCCCTCCCGGCCCTGTCGGTCCGCCCGGCAAGAATGGTTATCCCGGC
CCTCCTGGCAAGAACGGCTACGATGGGAAACAGGGTCCTCCTGGTCCTCCCGGCCCTCCTGGCCCTGCCGGCCCT
CCTGGCCCTGCCGGTCCCCCCGGTCCTCCCGGTCCTCCTGGCAAGCAGGGCCCTCCGGGAAAGCCTGGTTACGAC
GGCAAGAACGGCTATGACGGCAAGCAGGGTCCTCCCGGACCTCCTGGCCCTCCTGGCAAGTCGTACGAGAAGACG
TACGAGAAGCCGTACGAGAAGTCGTATGGGAAGACGGAGTATGGCAGCAACAACTATGGCACTCCTGCCTATGGT
GGCGGTGCTTCTTATGGTGGTTCTACCGACAACTACGGCGGCGGAAACGGTAACTACGGCGGCGGAAACGGTGGC
GGTGGCGATGGTTAT
Transcript >Ophio5|5932
ATGCGTTTCGAGACAGTTGCGACTTTGGTGGCCTTCGCGGGCAGCTGCCTGGCTGCCCCGAAGGTGGATGCCAAG
AACACGGCGACAGACAAGGCCGGCTCTTACGATGACCAGGGCGGCGATTCGTACGACAGCTATCAGCCGGCTCAG
GACAACTACCAGCAGAACAACTACGCCAAGCCCGAGTACAAGCAGCCCGAGTACAAGCAGACCGAGTACAAGACC
GAGTACAAGGTTGGTCCTCCGGGACCGCCCGGCAAGAACGGCTACGATGGGAAGCAGGGTCCTCCCGGCCCTCCC
GGTAAGGGCTACCCCGGCCCTCCCGGTCCACCTGGCCCTGTCGGCCCTCCGGGCAAGAACGGCTACCCTGGAGCG
CCGGGCAAACCCGGGCCCCCGGGCAAGAATGGTTATCCCGGTCCTCCTGGCAAGAATGGTTATCCCGGTCCTCCT
GGCAAGAACGGCTACGATGGGAAACAGGGCCCTCCCGGCCCTGTCGGTCCGCCCGGCAAGAATGGTTATCCCGGC
CCTCCTGGCAAGAACGGCTACGATGGGAAACAGGGTCCTCCTGGTCCTCCCGGCCCTCCTGGCCCTGCCGGCCCT
CCTGGCCCTGCCGGTCCCCCCGGTCCTCCCGGTCCTCCTGGCAAGCAGGGCCCTCCGGGAAAGCCTGGTTACGAC
GGCAAGAACGGCTATGACGGCAAGCAGGGTCCTCCCGGACCTCCTGGCCCTCCTGGCAAGTCGTACGAGAAGACG
TACGAGAAGCCGTACGAGAAGTCGTATGGGAAGACGGAGTATGGCAGCAACAACTATGGCACTCCTGCCTATGGT
GGCGGTGCTTCTTATGGTGGTTCTACCGACAACTACGGCGGCGGAAACGGTAACTACGGCGGCGGAAACGGTGGC
GGTGGCGATGGTTATTAG
Gene >Ophio5|5932
ATGCGTTTCGAGACAGTTGCGACTTTGGTGGCCTTCGCGGGCAGCTGCCTGGCTGCCCCGAAGGTGGATGCCAAG
AACACGGCGACAGACAAGGCCGGCTCTTACGATGACCAGGGCGGCGATTCGTACGACAGCTATCAGCCGGCTCAG
GACAACTACCAGCAGAACAACTACGCCAAGCCCGAGTACAAGCAGCCCGAGTACAAGCAGACCGAGTACAAGACC
GAGTACAAGGTTGGTCCTCCGGGACCGCCCGGCAAGAACGGCTACGATGGGAAGCAGGGTCCTCCCGGCCCTCCC
GGTAAGGGCTACCCCGGCCCTCCCGGTCCACCTGGCCCTGTCGGCCCTCCGGGCAAGAACGGCTACCCTGGAGCG
CCGGGCAAACCCGGGCCCCCGGGCAAGAATGGTTATCCCGGTCCTCCTGGCAAGAATGGTTATCCCGGTCCTCCT
GGCAAGAACGGCTACGATGGGAAACAGGGCCCTCCCGGCCCTGTCGGTCCGCCCGGCAAGAATGGTTATCCCGGC
CCTCCTGGCAAGAACGGCTACGATGGGAAACAGGGTCCTCCTGGTCCTCCCGGCCCTCCTGGCCCTGCCGGCCCT
CCTGGCCCTGCCGGTCCCCCCGGTCCTCCCGGTCCTCCTGGCAAGCAGGGCCCTCCGGGAAAGCCTGGTTACGAC
GGCAAGAACGGCTATGACGGCAAGCAGGGTCCTCCCGGACCTCCTGGCCCTCCTGGCAAGTCGTACGAGAAGACG
TACGAGAAGCCGTACGAGAAGTCGTATGGGAAGACGGAGTATGGCAGCAACAACTATGGCACTCCTGCCTATGGT
GGCGGTGCTTCTTATGGTGGTTCTACCGACAACTACGGCGGCGGAAACGGTAACTACGGCGGCGGAAACGGTGGC
GGTGGCGATGGTTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail