Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5931
Gene name
Locationscaffold_5:91774..92760
Strand-
Gene length (bp)986
Transcript length (bp)885
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11712 Vma12 Endoplasmic reticulum-based factor for assembly of V-ATPase 1.1E-41 84 233

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly Yes
GO:0043933 protein-containing complex organization No
GO:0009987 cellular process No
GO:0022607 cellular component assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0070070 proton-transporting V-type ATPase complex assembly No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0065003 protein-containing complex assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 176 195 19
2 205 227 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5931
MSKQRTTPSCSRSSGSTPCSQIYGNKADAVEGLERLGTKVESDDDGPEPSLARPAVGKPISHGQIVYLWTTLQSW
QHSSYSLEKLLQGSRVFVPPPPPKREPSDEYKALMARLRHEEASRAYQRMVKPSIPNETFHDGFPTAAQTFATVN
RPAHAADLGDDEDEVTYAEVQRQVMLIINFLVSIVGVAGTLWVVARWWSLPARLLLALSGAMVVAVAETVVYRAY
VWRMGQARVKQKAVSETKEVVNTWVVGQGARDDKDSPILLKSRRDSLGGAARRRIPAATEPPEGETKEA
Coding >Ophio5|5931
ATGAGTAAGCAGCGAACAACACCAAGCTGCTCTCGCTCCAGTGGTAGCACACCTTGCAGCCAAATCTATGGAAAC
AAGGCCGATGCGGTCGAGGGCCTCGAGAGGCTCGGGACGAAAGTTGAGTCCGATGACGACGGCCCTGAGCCCTCG
CTAGCCCGGCCCGCAGTCGGCAAGCCCATCTCCCACGGCCAGATAGTCTACTTATGGACGACGCTGCAATCATGG
CAGCACTCATCCTACAGTCTGGAAAAGCTCCTTCAGGGCTCCCGCGTCTTCGTTCCTCCGCCGCCGCCCAAGCGT
GAGCCATCAGACGAGTACAAGGCGCTCATGGCCCGTCTTCGGCATGAAGAGGCTTCTCGCGCTTACCAACGGATG
GTCAAACCGTCCATTCCAAACGAGACCTTTCACGATGGCTTCCCGACCGCAGCGCAGACCTTTGCCACCGTGAAC
CGTCCGGCGCACGCGGCCGACTTGGGAGACGACGAGGACGAAGTAACGTACGCAGAGGTGCAGCGCCAGGTCATG
CTCATCATCAACTTTCTCGTGAGCATCGTGGGCGTCGCGGGGACGCTGTGGGTGGTGGCGCGGTGGTGGAGCCTC
CCTGCCCGCTTGCTTCTCGCCTTGAGTGGCGCCATGGTCGTGGCTGTCGCCGAGACGGTCGTCTATCGTGCGTAC
GTTTGGAGGATGGGTCAGGCTAGGGTCAAGCAAAAGGCCGTGAGTGAGACCAAAGAGGTGGTCAATACGTGGGTC
GTAGGCCAAGGTGCCCGCGACGACAAGGACTCGCCTATTCTTCTGAAATCCAGGCGGGACAGTCTCGGTGGTGCA
GCCCGGAGACGAATCCCAGCAGCGACTGAGCCTCCGGAGGGCGAGACGAAAGAAGCC
Transcript >Ophio5|5931
ATGAGTAAGCAGCGAACAACACCAAGCTGCTCTCGCTCCAGTGGTAGCACACCTTGCAGCCAAATCTATGGAAAC
AAGGCCGATGCGGTCGAGGGCCTCGAGAGGCTCGGGACGAAAGTTGAGTCCGATGACGACGGCCCTGAGCCCTCG
CTAGCCCGGCCCGCAGTCGGCAAGCCCATCTCCCACGGCCAGATAGTCTACTTATGGACGACGCTGCAATCATGG
CAGCACTCATCCTACAGTCTGGAAAAGCTCCTTCAGGGCTCCCGCGTCTTCGTTCCTCCGCCGCCGCCCAAGCGT
GAGCCATCAGACGAGTACAAGGCGCTCATGGCCCGTCTTCGGCATGAAGAGGCTTCTCGCGCTTACCAACGGATG
GTCAAACCGTCCATTCCAAACGAGACCTTTCACGATGGCTTCCCGACCGCAGCGCAGACCTTTGCCACCGTGAAC
CGTCCGGCGCACGCGGCCGACTTGGGAGACGACGAGGACGAAGTAACGTACGCAGAGGTGCAGCGCCAGGTCATG
CTCATCATCAACTTTCTCGTGAGCATCGTGGGCGTCGCGGGGACGCTGTGGGTGGTGGCGCGGTGGTGGAGCCTC
CCTGCCCGCTTGCTTCTCGCCTTGAGTGGCGCCATGGTCGTGGCTGTCGCCGAGACGGTCGTCTATCGTGCGTAC
GTTTGGAGGATGGGTCAGGCTAGGGTCAAGCAAAAGGCCGTGAGTGAGACCAAAGAGGTGGTCAATACGTGGGTC
GTAGGCCAAGGTGCCCGCGACGACAAGGACTCGCCTATTCTTCTGAAATCCAGGCGGGACAGTCTCGGTGGTGCA
GCCCGGAGACGAATCCCAGCAGCGACTGAGCCTCCGGAGGGCGAGACGAAAGAAGCCTGA
Gene >Ophio5|5931
ATGAGTAAGCAGCGAACAACACCAAGCTGCTCTCGCTCCAGTGGTAGCACACCTTGCAGCCAAATCTATGGAAAC
AAGGCCGATGCGGGTACGATCGACAGCAATATGGTGCTCCTCACTATGACACCGCTCATAGTCGAGGGCCTCGAG
AGGCTCGGGACGAAAGTTGAGTCCGATGACGACGGCCCTGAGCCCTCGCTAGCCCGGCCCGCAGTCGGCAAGCCC
ATCTCCCACGGCCAGATAGTCTACTTATGGACGACGCTGCAATCATGGCAGCACTCATCCTACAGTCTGGAAAAG
CTCCTTCAGGGCTCCCGCGTCTTCGTTCCTCCGCCGCCGCCCAAGCGTGAGCCAGTCCGTTGTTCCCATCGACAT
GTCAGCCTCGGACGAGCGCTGACGGGCTGCAGTCAGACGAGTACAAGGCGCTCATGGCCCGTCTTCGGCATGAAG
AGGCTTCTCGCGCTTACCAACGGATGGTCAAACCGTCCATTCCAAACGAGACCTTTCACGATGGCTTCCCGACCG
CAGCGCAGACCTTTGCCACCGTGAACCGTCCGGCGCACGCGGCCGACTTGGGAGACGACGAGGACGAAGTAACGT
ACGCAGAGGTGCAGCGCCAGGTCATGCTCATCATCAACTTTCTCGTGAGCATCGTGGGCGTCGCGGGGACGCTGT
GGGTGGTGGCGCGGTGGTGGAGCCTCCCTGCCCGCTTGCTTCTCGCCTTGAGTGGCGCCATGGTCGTGGCTGTCG
CCGAGACGGTCGTCTATCGTGCGTACGTTTGGAGGATGGGTCAGGCTAGGGTCAAGCAAAAGGCCGTGAGTGAGA
CCAAAGAGGTGGTCAATACGTGGGTCGTAGGCCAAGGTGCCCGCGACGACAAGGACTCGCCTATTCTTCTGAAAT
CCAGGCGGGACAGTCTCGGTGGTGCAGCCCGGAGACGAATCCCAGCAGCGACTGAGCCTCCGGAGGGCGAGACGA
AAGAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail