Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|593
Gene name
Locationscaffold_1158:1486..2683
Strand-
Gene length (bp)1197
Transcript length (bp)1197
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 12 314 7.0E-96
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 10 314 7.0E-95
sp|Q0C7P6|EGLC_ASPTN Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglC PE=3 SV=1 23 325 2.0E-93
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 12 312 2.0E-90
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 23 312 4.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 12 314 7.0E-96
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 10 314 7.0E-95
sp|Q0C7P6|EGLC_ASPTN Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglC PE=3 SV=1 23 325 2.0E-93
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 12 312 2.0E-90
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 23 312 4.0E-88
sp|Q4WG16|EGLC_ASPFU Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglC PE=3 SV=1 23 312 5.0E-88
sp|A1DJ47|EGLC_NEOFI Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglC PE=3 SV=1 23 312 1.0E-87
sp|A1CD22|EGLC_ASPCL Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglC PE=3 SV=1 23 312 5.0E-84
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 24 291 9.0E-18
sp|D4B2W4|BGL2_ARTBC Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02797 PE=1 SV=1 1 290 1.0E-17
sp|P15703|BGL2_YEAST Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BGL2 PE=1 SV=1 24 273 6.0E-17
sp|P43070|BGL2_CANAX Glucan 1,3-beta-glucosidase OS=Candida albicans GN=BGL2 PE=3 SV=1 3 273 2.0E-14
sp|Q5AMT2|BGL2_CANAL Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BGL2 PE=1 SV=1 1 273 5.0E-13
sp|A2QN74|BTGC_ASPNC Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=btgC PE=3 SV=2 61 289 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 103.72 56.47 150.97
CcL In ants, during behavior modification 80.82 15.44 146.20
CcD In ants, recently dead 0.64 0.00 1.45

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.466553 no
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|593
MRLATSLVSAGLAACVAAHGSNYLGFNSGATKADYSAKFKADFEAEFRTSQNLQGAPGKFNAVRLYTNIQAYSQN
EPIQAFDAAVSTQTRVLLGIWASGTTSIDKELAALQAAVKKLGKSFTDLVIGISIGSEDLYRNSQTGDKNKAGVG
SSVETIVGFIKQFRREFANGPLAKVPVGHVDTWDAWTNATNRPVIDNIDWLGVDEYPSYQSGEGNSIDNAARLFE
EAYRKTLGVSGGKPVWVTETGWPLSGPDWDQAKASVDNSKRYWREIGCRKLFNKVPTFWYNLRDSNPANKLKFAI
TKDLSTKPLFDLSCPAKFATTSEMMSDNTTDTASSTATAAATSSSNVRAPTTSAASAAGKAASATPSSSAATGSW
GQRVYGAVYGGLLLAVATIMVLS
Coding >Ophio5|593
ATGCGTCTCGCCACGTCTCTCGTCTCTGCTGGCCTCGCCGCCTGCGTCGCCGCTCACGGTAGCAACTACCTGGGC
TTCAACTCGGGTGCCACAAAGGCCGATTACTCGGCCAAGTTCAAGGCCGACTTTGAAGCCGAGTTCCGCACTTCC
CAGAACCTCCAAGGCGCTCCCGGCAAGTTCAACGCCGTCCGTCTCTACACCAACATCCAGGCCTACTCGCAGAAC
GAGCCCATCCAGGCCTTCGACGCCGCCGTCAGCACCCAGACGCGCGTCCTGCTCGGCATCTGGGCCTCGGGCACC
ACTTCCATCGACAAGGAGCTCGCGGCGCTGCAGGCGGCTGTCAAGAAGCTCGGCAAGAGCTTCACCGACCTCGTC
ATCGGCATCTCCATCGGTAGCGAGGACCTGTATCGCAACTCGCAGACGGGCGACAAGAACAAGGCCGGCGTTGGC
AGCTCCGTCGAGACCATCGTCGGCTTCATCAAGCAGTTCCGCCGCGAGTTTGCCAACGGGCCCCTGGCCAAGGTG
CCCGTCGGTCACGTCGACACTTGGGATGCTTGGACCAACGCAACGAACCGGCCTGTCATCGACAACATCGACTGG
CTCGGCGTCGACGAGTATCCCAGCTACCAGAGCGGCGAGGGAAACAGCATCGACAACGCCGCCCGCCTGTTCGAG
GAGGCCTACCGCAAGACGCTCGGCGTCTCCGGCGGCAAGCCTGTCTGGGTTACGGAGACGGGCTGGCCCCTCTCC
GGCCCCGACTGGGACCAGGCCAAGGCCAGCGTCGACAACTCGAAGCGATACTGGCGCGAGATTGGCTGCCGCAAG
CTCTTCAACAAGGTCCCGACCTTTTGGTACAACCTGAGAGACTCCAACCCGGCCAACAAGCTCAAGTTCGCCATC
ACCAAGGACCTGTCCACCAAGCCTTTGTTCGACCTCTCTTGCCCGGCCAAGTTTGCCACCACCTCGGAGATGATG
TCGGATAACACGACGGATACCGCCAGCAGCACCGCCACCGCTGCTGCAACCTCGTCGTCGAACGTCCGCGCCCCG
ACGACGAGCGCGGCTTCGGCTGCCGGTAAGGCGGCCTCGGCTACTCCCAGCTCCAGTGCCGCGACCGGGTCTTGG
GGCCAGCGCGTGTACGGTGCCGTCTACGGTGGACTTTTGTTGGCCGTCGCCACCATCATGGTCCTCTCT
Transcript >Ophio5|593
ATGCGTCTCGCCACGTCTCTCGTCTCTGCTGGCCTCGCCGCCTGCGTCGCCGCTCACGGTAGCAACTACCTGGGC
TTCAACTCGGGTGCCACAAAGGCCGATTACTCGGCCAAGTTCAAGGCCGACTTTGAAGCCGAGTTCCGCACTTCC
CAGAACCTCCAAGGCGCTCCCGGCAAGTTCAACGCCGTCCGTCTCTACACCAACATCCAGGCCTACTCGCAGAAC
GAGCCCATCCAGGCCTTCGACGCCGCCGTCAGCACCCAGACGCGCGTCCTGCTCGGCATCTGGGCCTCGGGCACC
ACTTCCATCGACAAGGAGCTCGCGGCGCTGCAGGCGGCTGTCAAGAAGCTCGGCAAGAGCTTCACCGACCTCGTC
ATCGGCATCTCCATCGGTAGCGAGGACCTGTATCGCAACTCGCAGACGGGCGACAAGAACAAGGCCGGCGTTGGC
AGCTCCGTCGAGACCATCGTCGGCTTCATCAAGCAGTTCCGCCGCGAGTTTGCCAACGGGCCCCTGGCCAAGGTG
CCCGTCGGTCACGTCGACACTTGGGATGCTTGGACCAACGCAACGAACCGGCCTGTCATCGACAACATCGACTGG
CTCGGCGTCGACGAGTATCCCAGCTACCAGAGCGGCGAGGGAAACAGCATCGACAACGCCGCCCGCCTGTTCGAG
GAGGCCTACCGCAAGACGCTCGGCGTCTCCGGCGGCAAGCCTGTCTGGGTTACGGAGACGGGCTGGCCCCTCTCC
GGCCCCGACTGGGACCAGGCCAAGGCCAGCGTCGACAACTCGAAGCGATACTGGCGCGAGATTGGCTGCCGCAAG
CTCTTCAACAAGGTCCCGACCTTTTGGTACAACCTGAGAGACTCCAACCCGGCCAACAAGCTCAAGTTCGCCATC
ACCAAGGACCTGTCCACCAAGCCTTTGTTCGACCTCTCTTGCCCGGCCAAGTTTGCCACCACCTCGGAGATGATG
TCGGATAACACGACGGATACCGCCAGCAGCACCGCCACCGCTGCTGCAACCTCGTCGTCGAACGTCCGCGCCCCG
ACGACGAGCGCGGCTTCGGCTGCCGGTAAGGCGGCCTCGGCTACTCCCAGCTCCAGTGCCGCGACCGGGTCTTGG
GGCCAGCGCGTGTACGGTGCCGTCTACGGTGGACTTTTGTTGGCCGTCGCCACCATCATGGTCCTCTCTTGA
Gene >Ophio5|593
ATGCGTCTCGCCACGTCTCTCGTCTCTGCTGGCCTCGCCGCCTGCGTCGCCGCTCACGGTAGCAACTACCTGGGC
TTCAACTCGGGTGCCACAAAGGCCGATTACTCGGCCAAGTTCAAGGCCGACTTTGAAGCCGAGTTCCGCACTTCC
CAGAACCTCCAAGGCGCTCCCGGCAAGTTCAACGCCGTCCGTCTCTACACCAACATCCAGGCCTACTCGCAGAAC
GAGCCCATCCAGGCCTTCGACGCCGCCGTCAGCACCCAGACGCGCGTCCTGCTCGGCATCTGGGCCTCGGGCACC
ACTTCCATCGACAAGGAGCTCGCGGCGCTGCAGGCGGCTGTCAAGAAGCTCGGCAAGAGCTTCACCGACCTCGTC
ATCGGCATCTCCATCGGTAGCGAGGACCTGTATCGCAACTCGCAGACGGGCGACAAGAACAAGGCCGGCGTTGGC
AGCTCCGTCGAGACCATCGTCGGCTTCATCAAGCAGTTCCGCCGCGAGTTTGCCAACGGGCCCCTGGCCAAGGTG
CCCGTCGGTCACGTCGACACTTGGGATGCTTGGACCAACGCAACGAACCGGCCTGTCATCGACAACATCGACTGG
CTCGGCGTCGACGAGTATCCCAGCTACCAGAGCGGCGAGGGAAACAGCATCGACAACGCCGCCCGCCTGTTCGAG
GAGGCCTACCGCAAGACGCTCGGCGTCTCCGGCGGCAAGCCTGTCTGGGTTACGGAGACGGGCTGGCCCCTCTCC
GGCCCCGACTGGGACCAGGCCAAGGCCAGCGTCGACAACTCGAAGCGATACTGGCGCGAGATTGGCTGCCGCAAG
CTCTTCAACAAGGTCCCGACCTTTTGGTACAACCTGAGAGACTCCAACCCGGCCAACAAGCTCAAGTTCGCCATC
ACCAAGGACCTGTCCACCAAGCCTTTGTTCGACCTCTCTTGCCCGGCCAAGTTTGCCACCACCTCGGAGATGATG
TCGGATAACACGACGGATACCGCCAGCAGCACCGCCACCGCTGCTGCAACCTCGTCGTCGAACGTCCGCGCCCCG
ACGACGAGCGCGGCTTCGGCTGCCGGTAAGGCGGCCTCGGCTACTCCCAGCTCCAGTGCCGCGACCGGGTCTTGG
GGCCAGCGCGTGTACGGTGCCGTCTACGGTGGACTTTTGTTGGCCGTCGCCACCATCATGGTCCTCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail