Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5925
Gene name
Locationscaffold_5:72500..75734
Strand+
Gene length (bp)3234
Transcript length (bp)3156
Coding sequence length (bp)3153
Protein length (aa) 1051

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 6.6E-07 859 944
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.8E-06 890 971
PF13857 Ank_5 Ankyrin repeats (many copies) 2.7E-06 910 955

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 888 999 6.0E-08
sp|P42773|CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens GN=CDKN2C PE=1 SV=1 879 978 5.0E-07
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 888 971 8.0E-07
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 888 979 2.0E-06
sp|Q60772|CDN2C_MOUSE Cyclin-dependent kinase 4 inhibitor C OS=Mus musculus GN=Cdkn2c PE=1 SV=1 891 978 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 888 999 6.0E-08
sp|P42773|CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens GN=CDKN2C PE=1 SV=1 879 978 5.0E-07
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 888 971 8.0E-07
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 888 979 2.0E-06
sp|Q60772|CDN2C_MOUSE Cyclin-dependent kinase 4 inhibitor C OS=Mus musculus GN=Cdkn2c PE=1 SV=1 891 978 2.0E-06
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 888 979 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5925
MFPRRVGFYLLSIAFILVLWSSKSHARPQIESAASDGLEGGPNQRQRVPPPYSEHRNFRAEAPPPYFPPRNPNDR
HSPPPAYSRYSRPQAFHGRYPSPNAFPPPRYSRFPPSPRPQERGRVRNGRFRGPAPPRPDDPVYDDAGHDRGSAQ
ENGAVRPEDVVYDDVGTARGSGQENGAVRPEDVVYDDVGTAGGSAQEKAETIPEDGLRESPIYDDVGQHGAPAQE
NAPARPENGYDDVGHARGPAQDSAVVLPEDHVYINVGRAGGSTTDNAARIPEDHVYSNVGQAGGSVSDNAQSIPE
DRPQDNPIYDDVGHAGEPAQDSAGTRPRDDVYETLGDDDAAVARPEDHVYETLRDDEAVARPKDDVYETLRDDDA
AARPKDHVYEVVKDDGAATRPKDDVHESPRRPGESAHDGATGRSAGRNNHGRPRPVNEDHIYEVLPGEREGHSHE
NGETAPEPPKRNKGMKVPFCKTGSAGPSKRTIEDCIWPEANDESSTLFDLLEDEAPVVDESSLSGRLEQLAEMAE
RNAEADFSDLVNKLEMQLPILEKNQWTLSQLRAQFKKLLPKQGIEDMLKSWEAEALIAVALPFYIADLVETFQKN
TTDLERAATATMVVPLVGCAVRAAADADQDSLAPISTELCFVGDALLFTPLAFVGIFTVMIAPIIRALEQRSPDH
VRGLRDREWKKQEAELLAHFKSTEWKTKFETWHSTQLAASLFIASEQRGLLKAIQNLSVEATEAERLNINRTVSH
HLAVTEKAMCASMQARKRQYERTLPTGSWVYDRATNLTEEFIKQYEDAAWKYYHDFVSTRFFWTEAQRLSYGEPL
RKELETMSRYLRSTALFAVDAVTIPETAKDFVTKALVLPPECDCPADAKESRETGFEQRPDTLLCATRKGYTDVV
DQLLKAPYFDVNVQDKEGNTALSLAAAKGDFDILEMLLHRGRAKPRIPNKRGETAQSLAEAGGYQDIVHLLQTWG
EAGVPCSYWDYGRKLQGHLEWQAGCFCTVTVQDWPDMDRFTGSGSRAIGRGNERDRDTCIQSEWRSGPHGERLTA
R
Coding >Ophio5|5925
ATGTTTCCCAGACGTGTCGGATTCTACCTGCTCTCCATCGCATTCATCCTAGTCCTCTGGTCTAGCAAAAGCCAT
GCGAGACCGCAAATCGAATCAGCTGCATCAGATGGCTTAGAAGGAGGTCCGAACCAACGGCAACGTGTTCCACCA
CCCTACTCGGAGCATAGAAACTTCAGAGCTGAAGCCCCACCTCCTTATTTCCCTCCACGAAACCCAAATGATAGG
CATAGTCCTCCGCCAGCCTATTCGAGGTATTCACGACCGCAGGCCTTTCACGGTCGATATCCCTCTCCCAATGCG
TTTCCCCCGCCTCGTTATTCAAGGTTTCCGCCCAGCCCACGGCCGCAAGAACGTGGTCGAGTGAGGAATGGCCGT
TTCAGAGGGCCGGCACCACCCCGTCCGGATGACCCCGTCTACGATGATGCCGGACATGATAGAGGGTCGGCCCAG
GAAAACGGGGCAGTTCGCCCGGAAGACGTCGTTTACGATGATGTCGGAACTGCTCGAGGATCGGGCCAGGAAAAC
GGCGCAGTTCGCCCGGAAGACGTCGTGTACGATGATGTCGGAACTGCTGGAGGATCAGCCCAAGAAAAGGCCGAA
ACTATCCCGGAAGACGGCCTCCGGGAAAGTCCTATATACGATGATGTCGGACAACATGGGGCGCCAGCCCAAGAG
AATGCACCCGCCCGCCCGGAGAATGGATACGACGATGTCGGACATGCTAGAGGGCCAGCCCAAGACAGCGCCGTA
GTCCTCCCGGAAGACCACGTCTATATTAATGTTGGACGGGCAGGAGGTTCGACCACGGATAACGCCGCAAGGATT
CCGGAAGACCACGTCTATAGTAATGTTGGACAGGCAGGAGGTTCGGTCTCGGATAACGCCCAAAGCATTCCGGAA
GACCGTCCCCAGGATAACCCCATCTACGATGATGTCGGACATGCTGGAGAGCCAGCCCAAGACAGCGCGGGAACC
CGGCCGAGAGATGACGTCTACGAAACGCTTGGAGATGACGACGCCGCAGTAGCTCGTCCGGAAGATCACGTCTAC
GAAACGCTCAGAGACGATGAGGCCGTAGCTCGTCCGAAAGATGACGTCTACGAAACGCTCAGAGATGATGACGCC
GCAGCTCGTCCGAAAGATCACGTCTACGAAGTCGTTAAAGACGATGGGGCCGCAACCCGTCCGAAAGATGACGTC
CACGAATCGCCTAGACGTCCTGGAGAGTCGGCTCACGATGGTGCTACGGGCCGTTCAGCCGGTCGCAACAACCAT
GGTCGGCCTCGGCCTGTGAATGAGGACCATATTTACGAGGTTCTGCCGGGAGAGAGAGAAGGCCATTCTCACGAG
AACGGAGAGACGGCACCGGAGCCGCCGAAAAGAAACAAAGGCATGAAAGTACCGTTCTGCAAAACTGGTTCTGCG
GGTCCGTCCAAGAGGACGATCGAAGATTGTATATGGCCTGAAGCCAACGACGAGTCGAGCACCTTGTTTGACCTC
TTGGAGGATGAGGCTCCCGTGGTGGACGAGTCCTCACTTAGTGGGAGACTGGAACAACTGGCGGAAATGGCCGAG
AGAAATGCGGAAGCCGACTTCTCGGACCTTGTGAACAAACTCGAGATGCAGCTACCTATACTCGAGAAGAATCAA
TGGACCCTCAGCCAATTGCGGGCGCAATTCAAGAAGCTGCTCCCGAAGCAAGGGATAGAGGACATGTTGAAATCG
TGGGAGGCCGAAGCTCTCATCGCTGTCGCCCTGCCCTTCTATATCGCAGACCTGGTCGAAACATTTCAAAAGAAT
ACGACCGATCTGGAGCGTGCAGCGACGGCGACCATGGTCGTACCCTTGGTCGGCTGTGCGGTCCGGGCTGCTGCG
GACGCGGACCAAGACTCTCTGGCTCCAATCAGCACAGAGCTTTGCTTTGTCGGGGATGCCCTCTTGTTCACTCCC
CTCGCCTTTGTGGGCATCTTCACTGTCATGATAGCACCCATCATCCGTGCCCTCGAGCAGAGGAGTCCGGACCAC
GTCCGGGGGCTCCGCGACAGAGAGTGGAAGAAACAGGAGGCCGAGCTACTCGCTCACTTCAAATCGACCGAATGG
AAGACCAAGTTTGAAACTTGGCATTCGACTCAGCTGGCCGCCAGCTTGTTTATAGCGTCGGAGCAGAGAGGCTTG
TTGAAGGCGATACAGAACCTCTCCGTCGAGGCCACCGAGGCGGAGCGGCTCAACATCAACCGTACCGTGTCCCAT
CACTTGGCCGTCACGGAAAAGGCCATGTGTGCCAGCATGCAGGCTCGCAAGCGTCAATATGAGAGGACGCTCCCG
ACCGGAAGCTGGGTGTACGATCGAGCGACAAACTTGACCGAGGAATTCATCAAACAGTATGAAGACGCGGCCTGG
AAATACTATCATGATTTCGTGAGCACGCGCTTTTTCTGGACCGAAGCGCAGAGATTGAGCTACGGCGAGCCATTG
AGAAAGGAGCTCGAAACCATGAGCAGATACCTGCGGTCGACGGCTCTCTTCGCCGTCGACGCTGTCACCATTCCT
GAGACTGCCAAAGATTTTGTCACCAAGGCGCTGGTCTTGCCCCCTGAGTGCGACTGCCCAGCCGACGCCAAGGAG
AGTCGGGAGACTGGATTCGAACAACGGCCAGATACGCTTCTATGTGCGACACGGAAAGGATACACTGACGTCGTT
GACCAGCTCCTGAAGGCTCCTTATTTCGATGTCAACGTACAAGACAAGGAAGGAAACACGGCGCTTTCGCTGGCG
GCAGCCAAGGGCGACTTTGACATTCTTGAGATGCTTCTACACCGGGGCAGAGCCAAGCCCAGAATTCCAAACAAG
CGGGGAGAAACGGCACAATCTCTGGCAGAGGCTGGCGGATACCAGGATATTGTCCATCTGCTCCAGACGTGGGGT
GAAGCCGGTGTCCCATGCTCCTATTGGGACTACGGGAGAAAGTTGCAGGGCCATCTCGAATGGCAAGCCGGTTGC
TTCTGCACAGTCACCGTCCAAGACTGGCCGGACATGGACCGATTCACGGGCTCTGGGAGTCGTGCGATTGGTCGG
GGAAACGAACGTGATCGCGACACTTGTATTCAGTCGGAATGGAGATCGGGACCGCACGGAGAGCGCTTGACTGCC
CGG
Transcript >Ophio5|5925
ATGTTTCCCAGACGTGTCGGATTCTACCTGCTCTCCATCGCATTCATCCTAGTCCTCTGGTCTAGCAAAAGCCAT
GCGAGACCGCAAATCGAATCAGCTGCATCAGATGGCTTAGAAGGAGGTCCGAACCAACGGCAACGTGTTCCACCA
CCCTACTCGGAGCATAGAAACTTCAGAGCTGAAGCCCCACCTCCTTATTTCCCTCCACGAAACCCAAATGATAGG
CATAGTCCTCCGCCAGCCTATTCGAGGTATTCACGACCGCAGGCCTTTCACGGTCGATATCCCTCTCCCAATGCG
TTTCCCCCGCCTCGTTATTCAAGGTTTCCGCCCAGCCCACGGCCGCAAGAACGTGGTCGAGTGAGGAATGGCCGT
TTCAGAGGGCCGGCACCACCCCGTCCGGATGACCCCGTCTACGATGATGCCGGACATGATAGAGGGTCGGCCCAG
GAAAACGGGGCAGTTCGCCCGGAAGACGTCGTTTACGATGATGTCGGAACTGCTCGAGGATCGGGCCAGGAAAAC
GGCGCAGTTCGCCCGGAAGACGTCGTGTACGATGATGTCGGAACTGCTGGAGGATCAGCCCAAGAAAAGGCCGAA
ACTATCCCGGAAGACGGCCTCCGGGAAAGTCCTATATACGATGATGTCGGACAACATGGGGCGCCAGCCCAAGAG
AATGCACCCGCCCGCCCGGAGAATGGATACGACGATGTCGGACATGCTAGAGGGCCAGCCCAAGACAGCGCCGTA
GTCCTCCCGGAAGACCACGTCTATATTAATGTTGGACGGGCAGGAGGTTCGACCACGGATAACGCCGCAAGGATT
CCGGAAGACCACGTCTATAGTAATGTTGGACAGGCAGGAGGTTCGGTCTCGGATAACGCCCAAAGCATTCCGGAA
GACCGTCCCCAGGATAACCCCATCTACGATGATGTCGGACATGCTGGAGAGCCAGCCCAAGACAGCGCGGGAACC
CGGCCGAGAGATGACGTCTACGAAACGCTTGGAGATGACGACGCCGCAGTAGCTCGTCCGGAAGATCACGTCTAC
GAAACGCTCAGAGACGATGAGGCCGTAGCTCGTCCGAAAGATGACGTCTACGAAACGCTCAGAGATGATGACGCC
GCAGCTCGTCCGAAAGATCACGTCTACGAAGTCGTTAAAGACGATGGGGCCGCAACCCGTCCGAAAGATGACGTC
CACGAATCGCCTAGACGTCCTGGAGAGTCGGCTCACGATGGTGCTACGGGCCGTTCAGCCGGTCGCAACAACCAT
GGTCGGCCTCGGCCTGTGAATGAGGACCATATTTACGAGGTTCTGCCGGGAGAGAGAGAAGGCCATTCTCACGAG
AACGGAGAGACGGCACCGGAGCCGCCGAAAAGAAACAAAGGCATGAAAGTACCGTTCTGCAAAACTGGTTCTGCG
GGTCCGTCCAAGAGGACGATCGAAGATTGTATATGGCCTGAAGCCAACGACGAGTCGAGCACCTTGTTTGACCTC
TTGGAGGATGAGGCTCCCGTGGTGGACGAGTCCTCACTTAGTGGGAGACTGGAACAACTGGCGGAAATGGCCGAG
AGAAATGCGGAAGCCGACTTCTCGGACCTTGTGAACAAACTCGAGATGCAGCTACCTATACTCGAGAAGAATCAA
TGGACCCTCAGCCAATTGCGGGCGCAATTCAAGAAGCTGCTCCCGAAGCAAGGGATAGAGGACATGTTGAAATCG
TGGGAGGCCGAAGCTCTCATCGCTGTCGCCCTGCCCTTCTATATCGCAGACCTGGTCGAAACATTTCAAAAGAAT
ACGACCGATCTGGAGCGTGCAGCGACGGCGACCATGGTCGTACCCTTGGTCGGCTGTGCGGTCCGGGCTGCTGCG
GACGCGGACCAAGACTCTCTGGCTCCAATCAGCACAGAGCTTTGCTTTGTCGGGGATGCCCTCTTGTTCACTCCC
CTCGCCTTTGTGGGCATCTTCACTGTCATGATAGCACCCATCATCCGTGCCCTCGAGCAGAGGAGTCCGGACCAC
GTCCGGGGGCTCCGCGACAGAGAGTGGAAGAAACAGGAGGCCGAGCTACTCGCTCACTTCAAATCGACCGAATGG
AAGACCAAGTTTGAAACTTGGCATTCGACTCAGCTGGCCGCCAGCTTGTTTATAGCGTCGGAGCAGAGAGGCTTG
TTGAAGGCGATACAGAACCTCTCCGTCGAGGCCACCGAGGCGGAGCGGCTCAACATCAACCGTACCGTGTCCCAT
CACTTGGCCGTCACGGAAAAGGCCATGTGTGCCAGCATGCAGGCTCGCAAGCGTCAATATGAGAGGACGCTCCCG
ACCGGAAGCTGGGTGTACGATCGAGCGACAAACTTGACCGAGGAATTCATCAAACAGTATGAAGACGCGGCCTGG
AAATACTATCATGATTTCGTGAGCACGCGCTTTTTCTGGACCGAAGCGCAGAGATTGAGCTACGGCGAGCCATTG
AGAAAGGAGCTCGAAACCATGAGCAGATACCTGCGGTCGACGGCTCTCTTCGCCGTCGACGCTGTCACCATTCCT
GAGACTGCCAAAGATTTTGTCACCAAGGCGCTGGTCTTGCCCCCTGAGTGCGACTGCCCAGCCGACGCCAAGGAG
AGTCGGGAGACTGGATTCGAACAACGGCCAGATACGCTTCTATGTGCGACACGGAAAGGATACACTGACGTCGTT
GACCAGCTCCTGAAGGCTCCTTATTTCGATGTCAACGTACAAGACAAGGAAGGAAACACGGCGCTTTCGCTGGCG
GCAGCCAAGGGCGACTTTGACATTCTTGAGATGCTTCTACACCGGGGCAGAGCCAAGCCCAGAATTCCAAACAAG
CGGGGAGAAACGGCACAATCTCTGGCAGAGGCTGGCGGATACCAGGATATTGTCCATCTGCTCCAGACGTGGGGT
GAAGCCGGTGTCCCATGCTCCTATTGGGACTACGGGAGAAAGTTGCAGGGCCATCTCGAATGGCAAGCCGGTTGC
TTCTGCACAGTCACCGTCCAAGACTGGCCGGACATGGACCGATTCACGGGCTCTGGGAGTCGTGCGATTGGTCGG
GGAAACGAACGTGATCGCGACACTTGTATTCAGTCGGAATGGAGATCGGGACCGCACGGAGAGCGCTTGACTGCC
CGGTAG
Gene >Ophio5|5925
ATGTTTCCCAGACGTGTCGGATTCTACCTGCTCTCCATCGCATTCATCCTAGTCCTCTGGTCTAGCAAAAGCCAT
GCGAGACCGCAAATCGAATCAGCTGCATCAGATGGCTTAGAAGGAGGTCCGAACCAACGGCAACGTGTTCCACCA
CCCTACTCGGAGCATAGAAACTTCAGAGCTGAAGCCCCACCTCCTTATTTCCCTCCACGAAACCCAAATGATAGG
CATAGTCCTCCGCCAGCCTATTCGAGGTATTCACGACCGCAGGCCTTTCACGGTCGATATCCCTCTCCCAATGCG
TTTCCCCCGCCTCGTTATTCAAGGTTTCCGCCCAGCCCACGGCCGCAAGAACGTGGTCGAGTGAGGAATGGCCGT
TTCAGAGGGCCGGCACCACCCCGTCCGGATGACCCCGTCTACGATGATGCCGGACATGATAGAGGGTCGGCCCAG
GAAAACGGGGCAGTTCGCCCGGAAGACGTCGTTTACGATGATGTCGGAACTGCTCGAGGATCGGGCCAGGAAAAC
GGCGCAGTTCGCCCGGAAGACGTCGTGTACGATGATGTCGGAACTGCTGGAGGATCAGCCCAAGAAAAGGCCGAA
ACTATCCCGGAAGACGGCCTCCGGGAAAGTCCTATATACGATGATGTCGGACAACATGGGGCGCCAGCCCAAGAG
AATGCACCCGCCCGCCCGGAGAATGGATACGACGATGTCGGACATGCTAGAGGGCCAGCCCAAGACAGCGCCGTA
GTCCTCCCGGAAGACCACGTCTATATTAATGTTGGACGGGCAGGAGGTTCGACCACGGATAACGCCGCAAGGATT
CCGGAAGACCACGTCTATAGTAATGTTGGACAGGCAGGAGGTTCGGTCTCGGATAACGCCCAAAGCATTCCGGAA
GACCGTCCCCAGGATAACCCCATCTACGATGATGTCGGACATGCTGGAGAGCCAGCCCAAGACAGCGCGGGAACC
CGGCCGAGAGATGACGTCTACGAAACGCTTGGAGATGACGACGCCGCAGTAGCTCGTCCGGAAGATCACGTCTAC
GAAACGCTCAGAGACGATGAGGCCGTAGCTCGTCCGAAAGATGACGTCTACGAAACGCTCAGAGATGATGACGCC
GCAGCTCGTCCGAAAGATCACGTCTACGAAGTCGTTAAAGACGATGGGGCCGCAACCCGTCCGAAAGATGACGTC
CACGAATCGCCTAGACGTCCTGGAGAGTCGGCTCACGATGGTGCTACGGGCCGTTCAGCCGGTCGCAACAACCAT
GGTCGGCCTCGGCCTGTGAATGAGGACCATATTTACGAGGTTCTGCCGGGAGAGAGAGAAGGCCATTCTCACGAG
AACGGAGAGACGGCACCGGAGCCGCCGAAAAGAAACAAAGGCATGAAAGTACCGTTCTGCAAAACTGGTTCTGCG
GGTCCGTCCAAGAGGACGATCGAAGATTGTATATGGCCTGAAGCCAACGACGAGTCGAGCACCTTGTTTGACCTC
TTGGAGGATGAGGCTCCCGTGGTGGACGAGTCCTCACTTAGTGGGAGACTGGAACAACTGGCGGAAATGGCCGAG
AGAAATGCGGAAGCCGACTTCTCGGACCTTGTGAACAAACTCGAGATGCAGCTACCTATACTCGAGAAGAATCAA
TGGACCCTCAGCCAATTGCGGGCGCAATTCAAGAAGCTGCTCCCGAAGCAAGGGATAGAGGACATGTTGAAATCG
TGGGAGGCCGAAGCTCTCATCGCTGTCGCCCTGCCCTTCTATATCGCAGACCTGGTCGAAACATTTCAAAAGAAT
ACGACCGATCTGGAGCGTGCAGCGACGGCGACCATGGTCGTACCCTTGGTCGGCTGTGCGGTCCGGGCTGCTGCG
GACGCGGACCAAGACTCTCTGGCTCCAATCAGCACAGAGCTTTGCTTTGTCGGGGATGCCCTCTTGTTCACTCCC
CTCGCCTTTGTGGGCATCTTCACTGTCATGATAGCACCCATCATCCGTGCCCTCGAGCAGAGGAGTCCGGACCAC
GTCCGGGGGCTCCGCGACAGAGAGTGGAAGAAACAGGAGGCCGAGCTACTCGCTCACTTCAAATCGACCGAATGG
AAGACCAAGTTTGAAACTTGGCATTCGACTCAGCTGGCCGCCAGCTTGTTTATAGCGTCGGAGCAGAGAGGCTTG
TTGAAGGCGATACAGAACCTCTCCGTCGAGGCCACCGAGGCGGAGCGGCTCAACATCAACCGTACCGTGTCCCAT
CACTTGGCCGTCACGGAAAAGGCCATGTGTGCCAGCATGCAGGCTCGCAAGCGTCAATATGAGAGGACGCTCCCG
ACCGGAAGCTGGGTGTACGATCGAGCGACAAACTTGACCGAGGAATTCATCAAACAGTATGAAGACGCGGCCTGG
AAATACTATCATGATTTCGTGAGCACGCGCTTTTTCTGGACCGAAGCGCAGAGATTGAGCTACGGCGAGCCATTG
AGAAAGGAGCTCGAAACCATGAGCAGATACCTGCGGTCGACGGCTCTCTTCGCCGTCGACGCTGTCACCATTCCT
GAGACTGCCAAAGATTTTGTCACCAAGGCGCTGGTCTTGCCCCCTGAGTGCGACTGCCCAGCCGACGCCAAGGAG
AGTCGGGAGACTGGATTCGAACAACGGCCAGATACGCTTCTATGTGCGACACGGAAAGGATACACTGACGTCGTT
GACCAGCTCCTGAAGGCTCCTTATTTCGATGTCAACGTACAAGACAAGGAAGGAAACACGGCGCTTTCGCTGGCG
GCAGCCAAGGGCGACTTTGACATTCTTGAGATGCTTCTACACCGGGGCAGAGCCAAGCCCAGAATTCCAAACAAG
CGGGGAGAAACGGCACAATCTCTGGCAGAGGCTGGCGGATACCAGGATATTGTCCATCTGCTCCAGACGTGGGGT
GAAGCCGGTGTCCCATGCTCCTATTGGGACTACGGGAGAAAGTTGCAGGGCCATCTCGAATGGCAAGCCGGTTGC
TTCTGCACAGTCACCGTCCAAGACTGGCCGGACATGGACCGATTCACGGGCTCTGGGAGTCGTGCGATTGGTCGG
GGAAACGAACGTGATCGCGACACTTGTGTAAGTGCAAGGCTTTTTTTTGGGGGGGGGGGGGCTTCAGCGAGCTCC
TGCCGTCAGACACTAACATTTATACCTTAGATTCAGTCGGAATGGAGATCGGGACCGCACGGAGAGCGCTTGACT
GCCCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail