Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5920
Gene name
Locationscaffold_5:58229..59888
Strand+
Gene length (bp)1659
Transcript length (bp)1455
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.9E-21 83 315

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 76 422 3.0E-06
sp|P70187|HIAT1_MOUSE Hippocampus abundant transcript 1 protein OS=Mus musculus GN=Hiat1 PE=2 SV=3 82 420 7.0E-06
sp|Q96MC6|HIAT1_HUMAN Hippocampus abundant transcript 1 protein OS=Homo sapiens GN=HIAT1 PE=2 SV=2 82 420 8.0E-06
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 67 213 9.0E-06

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 112 134 22
3 141 163 22
4 178 200 22
5 207 226 19
6 278 300 22
7 321 340 19
8 350 372 22
9 404 426 22
10 436 458 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5920
MEETTPLLGRAPSDACRARSIVTLLSLVVFCLSCFGSLSSVPLNRLLEDRLCRQYGAQYARLSFIDEQVCKTDTV
QSQLAHLNGLLDTLEAVVGLLVAFPYGALSDKVGRKPIILLSITGFTLASAWMAFVLARDEVPIQTILLAPAFFL
VGGGRHVTFSTLFSAVSDVTTHENRASAFVTISLGSFMGGVVGPVVSSSLMQIASPWLPFLASFSLGLLGAIILM
LVPDTLLLGKQAPDDEDDDDDDYDKKAVPGSWQLRSHLSRLRAPFSMLQHPELVLVLFAFLAPVPMSTAANQFFV
QYVSKRFAWSMADAGYLQSVRGAVNVLLLLVVLPCLSRLLKDRSLARLSAALMTLGCLLMAANSIPLVVGGLVVN
TLGDGLAPLCRSLAANLVARHQQARLQTLIGIAEASSSLFAGPALAAALSAGMRWSGVWMGLPYFGLATFLFLTT
LPLFFLAVPTRSWREQSKAKDDDASKACLEDSSV
Coding >Ophio5|5920
ATGGAAGAGACGACGCCTCTCTTGGGCCGCGCGCCCTCCGATGCCTGTCGAGCTCGATCCATTGTCACTCTTTTG
TCACTCGTCGTCTTTTGCTTGTCCTGTTTCGGCTCCCTCAGCAGCGTTCCCTTGAATCGGCTGCTCGAGGACCGT
CTGTGTCGACAGTATGGCGCTCAATATGCCCGACTCTCCTTCATCGACGAGCAAGTCTGCAAGACAGATACGGTC
CAGTCCCAGCTTGCCCATCTCAACGGGCTGCTCGACACGCTCGAGGCCGTCGTCGGCCTCCTGGTCGCTTTCCCA
TACGGCGCCCTGTCCGACAAAGTCGGACGGAAGCCCATCATCCTGCTATCTATCACTGGCTTCACCCTCGCCTCA
GCATGGATGGCCTTTGTTCTAGCGCGCGACGAGGTGCCGATCCAGACCATTCTCCTTGCTCCGGCATTTTTCTTG
GTTGGCGGCGGCAGACATGTTACTTTCTCTACCCTCTTCTCTGCCGTGTCTGATGTGACGACGCATGAAAATCGG
GCATCGGCGTTTGTCACAATCTCGCTGGGAAGCTTCATGGGGGGAGTAGTCGGGCCCGTGGTCTCGTCGAGCCTC
ATGCAGATTGCCAGTCCATGGCTCCCGTTTCTCGCCAGCTTTTCCCTGGGGCTCCTTGGGGCTATCATATTGATG
CTCGTGCCCGACACTCTTCTCCTCGGCAAGCAGGCCCCAGATGATGAGGACGACGACGACGACGACTACGACAAA
AAGGCCGTCCCCGGCAGCTGGCAGCTTCGAAGCCACCTCTCTCGGCTCAGGGCACCGTTTAGCATGCTGCAGCAT
CCTGAGCTGGTTCTCGTGCTCTTCGCCTTCCTGGCGCCCGTGCCCATGTCGACGGCAGCGAACCAGTTCTTCGTC
CAGTACGTCAGCAAGCGCTTCGCCTGGTCCATGGCCGACGCCGGCTACCTGCAGTCGGTCCGCGGCGCCGTCAAC
GTGCTACTGCTGCTGGTCGTGCTCCCTTGCCTCAGCAGGCTTCTCAAGGACCGTTCCCTGGCCCGACTGTCTGCG
GCCTTGATGACGCTAGGCTGTCTCCTCATGGCGGCGAACAGCATCCCTTTGGTGGTGGGCGGCCTCGTCGTCAAC
ACGCTGGGCGATGGCCTGGCACCGCTGTGTCGCTCCCTGGCGGCCAACCTGGTCGCGAGGCACCAACAGGCCAGG
CTGCAGACGCTGATTGGCATCGCTGAGGCCTCGAGCTCGCTCTTTGCTGGCCCGGCTTTGGCTGCCGCCTTGTCC
GCTGGCATGAGGTGGAGCGGCGTCTGGATGGGTTTGCCGTACTTTGGCCTGGCTACTTTTCTCTTTCTCACCACT
CTGCCCTTGTTCTTCCTGGCCGTTCCGACTAGGTCTTGGCGAGAGCAGTCTAAGGCCAAGGACGACGACGCCTCG
AAGGCTTGTCTGGAGGACTCTTCGGTC
Transcript >Ophio5|5920
ATGGAAGAGACGACGCCTCTCTTGGGCCGCGCGCCCTCCGATGCCTGTCGAGCTCGATCCATTGTCACTCTTTTG
TCACTCGTCGTCTTTTGCTTGTCCTGTTTCGGCTCCCTCAGCAGCGTTCCCTTGAATCGGCTGCTCGAGGACCGT
CTGTGTCGACAGTATGGCGCTCAATATGCCCGACTCTCCTTCATCGACGAGCAAGTCTGCAAGACAGATACGGTC
CAGTCCCAGCTTGCCCATCTCAACGGGCTGCTCGACACGCTCGAGGCCGTCGTCGGCCTCCTGGTCGCTTTCCCA
TACGGCGCCCTGTCCGACAAAGTCGGACGGAAGCCCATCATCCTGCTATCTATCACTGGCTTCACCCTCGCCTCA
GCATGGATGGCCTTTGTTCTAGCGCGCGACGAGGTGCCGATCCAGACCATTCTCCTTGCTCCGGCATTTTTCTTG
GTTGGCGGCGGCAGACATGTTACTTTCTCTACCCTCTTCTCTGCCGTGTCTGATGTGACGACGCATGAAAATCGG
GCATCGGCGTTTGTCACAATCTCGCTGGGAAGCTTCATGGGGGGAGTAGTCGGGCCCGTGGTCTCGTCGAGCCTC
ATGCAGATTGCCAGTCCATGGCTCCCGTTTCTCGCCAGCTTTTCCCTGGGGCTCCTTGGGGCTATCATATTGATG
CTCGTGCCCGACACTCTTCTCCTCGGCAAGCAGGCCCCAGATGATGAGGACGACGACGACGACGACTACGACAAA
AAGGCCGTCCCCGGCAGCTGGCAGCTTCGAAGCCACCTCTCTCGGCTCAGGGCACCGTTTAGCATGCTGCAGCAT
CCTGAGCTGGTTCTCGTGCTCTTCGCCTTCCTGGCGCCCGTGCCCATGTCGACGGCAGCGAACCAGTTCTTCGTC
CAGTACGTCAGCAAGCGCTTCGCCTGGTCCATGGCCGACGCCGGCTACCTGCAGTCGGTCCGCGGCGCCGTCAAC
GTGCTACTGCTGCTGGTCGTGCTCCCTTGCCTCAGCAGGCTTCTCAAGGACCGTTCCCTGGCCCGACTGTCTGCG
GCCTTGATGACGCTAGGCTGTCTCCTCATGGCGGCGAACAGCATCCCTTTGGTGGTGGGCGGCCTCGTCGTCAAC
ACGCTGGGCGATGGCCTGGCACCGCTGTGTCGCTCCCTGGCGGCCAACCTGGTCGCGAGGCACCAACAGGCCAGG
CTGCAGACGCTGATTGGCATCGCTGAGGCCTCGAGCTCGCTCTTTGCTGGCCCGGCTTTGGCTGCCGCCTTGTCC
GCTGGCATGAGGTGGAGCGGCGTCTGGATGGGTTTGCCGTACTTTGGCCTGGCTACTTTTCTCTTTCTCACCACT
CTGCCCTTGTTCTTCCTGGCCGTTCCGACTAGGTCTTGGCGAGAGCAGTCTAAGGCCAAGGACGACGACGCCTCG
AAGGCTTGTCTGGAGGACTCTTCGGTCTAA
Gene >Ophio5|5920
ATGGAAGAGACGACGCCTCTCTTGGGCCGCGCGCCCTCCGATGCCTGTCGAGCTCGATCCATTGTCACTCTTTTG
TCACTCGTCGTCTTTTGCTTGTCCTGTTTCGGCTCCCTCAGCAGCGTTCCCTTGAATCGGCTGCTCGAGGACCGT
CTGTGTCGACAGTATGGCGCTCAATATGCCCGACTCTCCTTCATCGACGAGCAAGTCTGCAAGACAGATACGGTC
CAGTCCCAGCTTGCCCATCTCAACGGGCTGCTCGACACGCTCGAGGCCGTCGTCGGTTCGTTGACACCCTGGTTC
CGAAGCTCGTGCATAGTCGCGGAAAAGCTCATCCGCGTGTCGCAGGCCTCCTGGTCGCTTTCCCATACGGCGCCC
TGTCCGACAAGTAAACTTTATCCCTTCCTGTCCCTTGCTCCGGAAGACCATTAGTATCATGAACAGGGTTGATTA
ACGTTGGCGTCGGCAGAGTCGGACGGAAGCCCATCATCCTGCTATCTATCACTGGCTTCACCCTCGCCTCAGCAT
GGATGGCCTTTGTTCTAGCGCGCGACGAGGTGCCGATCCAGACCATTCTCCTTGCTCCGGCATTTTTCTTGGTTG
GCGGCGGCAGACATGTTACTTTCTCTACCCTCTTCTCTGCCGTGTCTGATGTGACGACGCATGAAAATCGGCATG
TTTATCATCATCCGCGACACCAAAAAAACAATCCATGACTGACCTTGTACAAGGGCATCGGCGTTTGTCACAATC
TCGCTGGGAAGCTTCATGGGGGGAGTAGTCGGGCCCGTGGTCTCGTCGAGCCTCATGCAGATTGCCAGTCCATGG
CTCCCGTTTCTCGCCAGCTTTTCCCTGGGGCTCCTTGGGGCTATCATATTGATGCTCGTGCCCGACACTCTTCTC
CTCGGCAAGCAGGCCCCAGATGATGAGGACGACGACGACGACGACTACGACAAAAAGGCCGTCCCCGGCAGCTGG
CAGCTTCGAAGCCACCTCTCTCGGCTCAGGGCACCGTTTAGCATGCTGCAGCATCCTGAGCTGGTTCTCGTGCTC
TTCGCCTTCCTGGCGCCCGTGCCCATGTCGACGGCAGCGAACCAGTTCTTCGTCCAGTACGTCAGCAAGCGCTTC
GCCTGGTCCATGGCCGACGCCGGCTACCTGCAGTCGGTCCGCGGCGCCGTCAACGTGCTACTGCTGCTGGTCGTG
CTCCCTTGCCTCAGCAGGCTTCTCAAGGACCGTTCCCTGGCCCGACTGTCTGCGGCCTTGATGACGCTAGGCTGT
CTCCTCATGGCGGCGAACAGCATCCCTTTGGTGGTGGGCGGCCTCGTCGTCAACACGCTGGGCGATGGCCTGGCA
CCGCTGTGTCGCTCCCTGGCGGCCAACCTGGTCGCGAGGCACCAACAGGCCAGGCTGCAGACGCTGATTGGCATC
GCTGAGGCCTCGAGCTCGCTCTTTGCTGGCCCGGCTTTGGCTGCCGCCTTGTCCGCTGGCATGAGGTGGAGCGGC
GTCTGGATGGGTTTGCCGTACTTTGGCCTGGCTACTTTTCTCTTTCTCACCACTCTGCCCTTGTTCTTCCTGGCC
GTTCCGACTAGGTCTTGGCGAGAGCAGTCTAAGGCCAAGGACGACGACGCCTCGAAGGCTTGTCTGGAGGACTCT
TCGGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail