Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5919
Gene name
Locationscaffold_5:55446..56721
Strand-
Gene length (bp)1275
Transcript length (bp)1104
Coding sequence length (bp)1101
Protein length (aa) 367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 1.3E-63 19 346

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G5EAZ3|CHIB1_EMENI Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiB PE=1 SV=1 48 346 1.0E-18
sp|Q92222|CHIB_EMEND Endochitinase B OS=Emericella nidulans GN=chiB PE=1 SV=3 48 346 1.0E-18
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 76 341 1.0E-17
sp|Q5AM60|CHI4_CANAL Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT4 PE=3 SV=1 76 347 4.0E-15
sp|Q06350|CHI2_YEAST Sporulation-specific chitinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS2 PE=1 SV=1 72 341 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G5EAZ3|CHIB1_EMENI Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiB PE=1 SV=1 48 346 1.0E-18
sp|Q92222|CHIB_EMEND Endochitinase B OS=Emericella nidulans GN=chiB PE=1 SV=3 48 346 1.0E-18
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 76 341 1.0E-17
sp|Q5AM60|CHI4_CANAL Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT4 PE=3 SV=1 76 347 4.0E-15
sp|Q06350|CHI2_YEAST Sporulation-specific chitinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS2 PE=1 SV=1 72 341 6.0E-15
sp|Q1E3R8|CHI1_COCIM Endochitinase 1 OS=Coccidioides immitis (strain RS) GN=CTS1 PE=3 SV=1 76 346 7.0E-15
sp|P0CB51|CHI1_COCPS Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CTS1 PE=1 SV=1 76 346 8.0E-15
sp|C5P230|CHI1_COCP7 Endochitinase 1 OS=Coccidioides posadasii (strain C735) GN=CTS1 PE=3 SV=1 76 346 8.0E-15
sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 76 346 1.0E-14
sp|P20533|CHIA1_BACCI Chitinase A1 OS=Bacillus circulans GN=chiA1 PE=1 SV=1 76 346 3.0E-14
sp|O14456|CHI1_METAN Endochitinase 1 OS=Metarhizium anisopliae GN=chit1 PE=1 SV=1 76 346 4.0E-14
sp|E9ERT9|CHI1_METRA Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chit1 PE=3 SV=1 76 348 5.0E-14
sp|P48827|CHI42_TRIHA Endochitinase 42 OS=Trichoderma harzianum GN=chit42 PE=1 SV=1 74 348 5.0E-14
sp|O35744|CHIL3_MOUSE Chitinase-like protein 3 OS=Mus musculus GN=Chil3 PE=1 SV=2 43 278 2.0E-13
sp|A6N6J0|CHI46_TRIHA Endochitinase 46 OS=Trichoderma harzianum GN=chit46 PE=1 SV=1 56 348 3.0E-13
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 65 346 5.0E-13
sp|E9QRF2|CHIB1_ASPFU Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiB1 PE=3 SV=1 76 346 9.0E-13
sp|Q873X9|CHIB1_ASPFM Endochitinase B1 OS=Neosartorya fumigata GN=chiB1 PE=1 SV=1 76 346 9.0E-13
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 66 346 3.0E-12
sp|Q9WTV1|CH3L1_RAT Chitinase-3-like protein 1 OS=Rattus norvegicus GN=Chi3l1 PE=2 SV=3 76 351 9.0E-12
sp|P11220|CHIT_STRPL Chitinase 63 OS=Streptomyces plicatus GN=chtA PE=1 SV=2 76 360 1.0E-11
sp|P36909|CHIT_STRLI Chitinase C OS=Streptomyces lividans GN=chiC PE=2 SV=1 64 357 2.0E-11
sp|Q61362|CH3L1_MOUSE Chitinase-3-like protein 1 OS=Mus musculus GN=Chi3l1 PE=1 SV=3 52 346 2.0E-11
sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 76 346 2.0E-11
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 74 353 3.0E-11
sp|Q9W092|CHIT2_DROME Probable chitinase 2 OS=Drosophila melanogaster GN=Cht2 PE=1 SV=1 76 346 3.0E-11
sp|P36222|CH3L1_HUMAN Chitinase-3-like protein 1 OS=Homo sapiens GN=CHI3L1 PE=1 SV=2 76 346 1.0E-10
sp|Q95M17|CHIA_BOVIN Acidic mammalian chitinase OS=Bos taurus GN=CHIA PE=1 SV=1 76 346 1.0E-10
sp|Q11174|CHIT_CAEEL Probable endochitinase OS=Caenorhabditis elegans GN=cht-1 PE=1 SV=1 40 346 2.0E-10
sp|Q5RBP6|CH3L1_PONAB Chitinase-3-like protein 1 OS=Pongo abelii GN=CHI3L1 PE=2 SV=1 76 346 2.0E-10
sp|Q6TMG6|CH3L1_SHEEP Chitinase-3-like protein 1 OS=Ovis aries GN=CHI3L1 PE=1 SV=1 76 351 3.0E-10
sp|Q9BZP6|CHIA_HUMAN Acidic mammalian chitinase OS=Homo sapiens GN=CHIA PE=1 SV=1 76 346 3.0E-10
sp|P11797|CHIB_SERMA Chitinase B OS=Serratia marcescens GN=chiB PE=1 SV=1 76 356 4.0E-10
sp|Q91Z98|CHIL4_MOUSE Chitinase-like protein 4 OS=Mus musculus GN=Chil4 PE=1 SV=2 76 278 4.0E-10
sp|Q28990|OVGP1_PIG Oviduct-specific glycoprotein OS=Sus scrofa GN=OVGP1 PE=2 SV=1 72 346 6.0E-10
sp|Q6RY07|CHIA_RAT Acidic mammalian chitinase OS=Rattus norvegicus GN=Chia PE=2 SV=1 76 346 8.0E-10
sp|Q29411|CH3L1_PIG Chitinase-3-like protein 1 OS=Sus scrofa GN=CHI3L1 PE=1 SV=2 76 351 1.0E-09
sp|H2A0L4|CHI1_PINMG Putative chitinase 1 OS=Pinctada margaritifera PE=1 SV=1 58 346 1.0E-09
sp|Q91XA9|CHIA_MOUSE Acidic mammalian chitinase OS=Mus musculus GN=Chia PE=1 SV=2 76 346 1.0E-09
sp|P29030|CHIT_BRUMA Endochitinase OS=Brugia malayi PE=1 SV=1 74 343 2.0E-09
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 68 353 3.0E-09
sp|Q28542|OVGP1_SHEEP Oviduct-specific glycoprotein OS=Ovis aries GN=OVGP1 PE=1 SV=1 72 351 3.0E-09
sp|Q7YS85|CH3L1_BUBBU Chitinase-3-like protein 1 OS=Bubalus bubalis GN=CHI3L1 PE=1 SV=3 76 351 3.0E-09
sp|P30922|CH3L1_BOVIN Chitinase-3-like protein 1 OS=Bos taurus GN=CHI3L1 PE=1 SV=3 76 351 4.0E-09
sp|Q28042|OVGP1_BOVIN Oviduct-specific glycoprotein (Fragment) OS=Bos taurus GN=OVGP1 PE=1 SV=1 72 351 6.0E-09
sp|Q8SPQ0|CH3L1_CAPHI Chitinase-3-like protein 1 OS=Capra hircus GN=CHI3L1 PE=1 SV=1 76 351 2.0E-08
sp|P36718|OVGP1_PAPAN Oviduct-specific glycoprotein OS=Papio anubis GN=OVGP1 PE=2 SV=2 76 246 3.0E-08
sp|P36362|CHIT_MANSE Endochitinase OS=Manduca sexta PE=2 SV=1 75 346 4.0E-08
sp|Q12889|OVGP1_HUMAN Oviduct-specific glycoprotein OS=Homo sapiens GN=OVGP1 PE=2 SV=1 76 246 5.0E-08
sp|P32823|CHIA_PSEO7 Chitinase A OS=Pseudoalteromonas piscicida GN=chiA PE=1 SV=1 76 349 5.0E-07
sp|P09805|KTXA_KLULA Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) PE=1 SV=1 75 200 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5919
MPLLAAAATVVSAAAPRYLMYLDQFHLATLPDKSMTAGINYVYTAFAPSSIFNDNSSYTFQKPLDEVRAMFDDGT
KLCMAIGGWADLEGFGAASATDESRKKFAKNVADALNNQGYDCVDMDWEYPGGNGEDYKQVPNDQKVGEIAAYPE
LMCAVKEAIGDKELSTAIPGKEGDMIAFTSENMPMLNNCTDFFNVMTYDLMNRRDTTTNHHSSVQGSAKSVDTYI
ERGMDPAKMNLGFPFYAKFFETKGECNEPVGCETVLLENPDGTDTGKSGAMTFELENAENPEFKKAMENGKSDDD
QGGMWYWDPDTKKFWTWDDPKYIDQKLDMAAEKKLGGAFAWSLAEDAQDWRHLKALQAGVSKLGQGQ
Coding >Ophio5|5919
ATGCCTCTTCTTGCGGCCGCCGCCACCGTCGTCTCGGCCGCTGCTCCGCGATACCTCATGTATCTTGATCAGTTT
CACTTGGCCACCCTCCCTGACAAGAGCATGACGGCCGGCATCAACTACGTCTACACTGCCTTTGCCCCATCATCC
ATCTTCAACGACAACTCGTCGTACACGTTTCAAAAACCGTTGGATGAGGTCCGCGCCATGTTCGACGATGGAACC
AAGCTTTGCATGGCCATCGGAGGGTGGGCCGACCTAGAGGGCTTCGGTGCTGCCTCCGCCACGGATGAGAGCCGC
AAGAAGTTTGCCAAAAACGTGGCAGATGCACTCAACAATCAAGGCTACGACTGCGTTGACATGGACTGGGAGTAT
CCCGGCGGCAATGGCGAGGACTACAAACAAGTGCCCAACGACCAGAAAGTGGGCGAGATTGCGGCCTACCCGGAA
CTCATGTGCGCCGTCAAGGAGGCCATTGGAGACAAGGAGCTGTCGACGGCCATTCCCGGCAAGGAGGGCGACATG
ATTGCCTTTACCTCGGAAAACATGCCCATGCTGAACAACTGCACCGACTTCTTTAATGTAATGACTTACGACCTG
ATGAACCGCCGCGACACCACCACCAATCACCACAGCTCTGTCCAGGGCAGTGCCAAATCGGTCGACACGTACATC
GAGCGTGGCATGGACCCGGCCAAGATGAACCTCGGCTTCCCCTTCTACGCCAAGTTCTTCGAGACCAAGGGCGAG
TGCAACGAGCCCGTGGGCTGCGAGACGGTACTGCTCGAGAACCCGGACGGCACCGATACGGGCAAGTCGGGCGCC
ATGACTTTCGAGCTCGAGAACGCCGAAAACCCCGAGTTCAAGAAGGCCATGGAGAACGGAAAATCGGATGACGAC
CAGGGCGGCATGTGGTACTGGGACCCGGATACCAAAAAGTTCTGGACGTGGGACGACCCCAAGTACATTGATCAG
AAGCTCGACATGGCCGCTGAGAAGAAGCTCGGCGGCGCTTTTGCCTGGAGCTTGGCTGAGGACGCGCAGGACTGG
AGGCACCTCAAGGCCCTGCAGGCCGGCGTGAGCAAGCTTGGCCAGGGGCAA
Transcript >Ophio5|5919
ATGCCTCTTCTTGCGGCCGCCGCCACCGTCGTCTCGGCCGCTGCTCCGCGATACCTCATGTATCTTGATCAGTTT
CACTTGGCCACCCTCCCTGACAAGAGCATGACGGCCGGCATCAACTACGTCTACACTGCCTTTGCCCCATCATCC
ATCTTCAACGACAACTCGTCGTACACGTTTCAAAAACCGTTGGATGAGGTCCGCGCCATGTTCGACGATGGAACC
AAGCTTTGCATGGCCATCGGAGGGTGGGCCGACCTAGAGGGCTTCGGTGCTGCCTCCGCCACGGATGAGAGCCGC
AAGAAGTTTGCCAAAAACGTGGCAGATGCACTCAACAATCAAGGCTACGACTGCGTTGACATGGACTGGGAGTAT
CCCGGCGGCAATGGCGAGGACTACAAACAAGTGCCCAACGACCAGAAAGTGGGCGAGATTGCGGCCTACCCGGAA
CTCATGTGCGCCGTCAAGGAGGCCATTGGAGACAAGGAGCTGTCGACGGCCATTCCCGGCAAGGAGGGCGACATG
ATTGCCTTTACCTCGGAAAACATGCCCATGCTGAACAACTGCACCGACTTCTTTAATGTAATGACTTACGACCTG
ATGAACCGCCGCGACACCACCACCAATCACCACAGCTCTGTCCAGGGCAGTGCCAAATCGGTCGACACGTACATC
GAGCGTGGCATGGACCCGGCCAAGATGAACCTCGGCTTCCCCTTCTACGCCAAGTTCTTCGAGACCAAGGGCGAG
TGCAACGAGCCCGTGGGCTGCGAGACGGTACTGCTCGAGAACCCGGACGGCACCGATACGGGCAAGTCGGGCGCC
ATGACTTTCGAGCTCGAGAACGCCGAAAACCCCGAGTTCAAGAAGGCCATGGAGAACGGAAAATCGGATGACGAC
CAGGGCGGCATGTGGTACTGGGACCCGGATACCAAAAAGTTCTGGACGTGGGACGACCCCAAGTACATTGATCAG
AAGCTCGACATGGCCGCTGAGAAGAAGCTCGGCGGCGCTTTTGCCTGGAGCTTGGCTGAGGACGCGCAGGACTGG
AGGCACCTCAAGGCCCTGCAGGCCGGCGTGAGCAAGCTTGGCCAGGGGCAATAG
Gene >Ophio5|5919
ATGCCTCTTCTTGCGGCCGCCGCCACCGTCGTCTCGGCCGCTGCTCCGCGATACCTCATGTATCTTGATCAGTAG
GTGCATCTGTCGACACCAAACGCGAGCAAACTTCTCACAACGCCTCCCTCACCCGCAGGTTTCACTTGGCCACCC
TCCCTGACAAGAGCATGACGGCCGGCATCAACTACGTCTACACTGCCTTTGCCCCATCATCCATCTTCAACGACA
ACTCGTCGTACACGTTTCAAAAACCGTTGGATGAGGTCCGCGCCATGTTCGACGATGGAACCAAGCTTTGCATGG
CCATCGGAGGGTGGGCCGACCTAGAGGGCTTCGGTGCTGCCTCCGCCACGGATGAGAGCCGCAAGAAGTTTGCCA
AAAACGTGGCAGATGCACTCAACAATCAAGGCTACGACTGCGTTGGTGAGTGACGGGACGCCAACGACGCAAAGA
CGTCGACTGACAATGTCTTGTAGACATGGACTGGGAGTATCCCGGCGGCAATGGCGAGGACTACAAACAAGTGCC
CAACGACCAGAAAGTGGGCGAGATTGCGGCCTACCCGGAACTCATGTGCGCCGTCAAGGAGGCCATTGGAGACAA
GGAGCTGTCGACGGCCATTCCCGGCAAGGAGGGCGACATGATTGCCTTTACCTCGGAAAACATGCCCATGCTGAA
CAACTGCACCGACTTCTTTAATGTGAGTTGGTCATTCTGGGGACAGCAAGACGACGACATCTGACTTGACGGCCC
CAGGTAATGACTTACGACCTGATGAACCGCCGCGACACCACCACCAATCACCACAGCTCTGTCCAGGGCAGTGCC
AAATCGGTCGACACGTACATCGAGCGTGGCATGGACCCGGCCAAGATGAACCTCGGCTTCCCCTTCTACGCCAAG
TTCTTCGAGACCAAGGGCGAGTGCAACGAGCCCGTGGGCTGCGAGACGGTACTGCTCGAGAACCCGGACGGCACC
GATACGGGCAAGTCGGGCGCCATGACTTTCGAGCTCGAGAACGCCGAAAACCCCGAGTTCAAGAAGGCCATGGAG
AACGGAAAATCGGATGACGACCAGGGCGGCATGTGGTACTGGGACCCGGATACCAAAAAGTTCTGGACGTGGGAC
GACCCCAAGTACATTGATCAGAAGCTCGACATGGCCGCTGAGAAGAAGCTCGGCGGCGCTTTTGCCTGGAGCTTG
GCTGAGGACGCGCAGGACTGGAGGCACCTCAAGGCCCTGCAGGCCGGCGTGAGCAAGCTTGGCCAGGGGCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail