Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5915
Gene name
Locationscaffold_5:49789..52033
Strand-
Gene length (bp)2244
Transcript length (bp)2019
Coding sequence length (bp)2016
Protein length (aa) 672

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 4.4E-73 45 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04121|NHX1_YEAST Endosomal/prevacuolar sodium/hydrogen exchanger OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHX1 PE=1 SV=1 19 598 0.0E+00
sp|O13726|YDO6_SCHPO Uncharacterized Na(+)/H(+) antiporter C15A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15A10.06 PE=1 SV=3 30 472 1.0E-176
sp|Q92581|SL9A6_HUMAN Sodium/hydrogen exchanger 6 OS=Homo sapiens GN=SLC9A6 PE=1 SV=2 57 583 3.0E-83
sp|Q8BZ00|SL9A9_MOUSE Sodium/hydrogen exchanger 9 OS=Mus musculus GN=Slc9a9 PE=2 SV=1 86 466 4.0E-83
sp|Q8IVB4|SL9A9_HUMAN Sodium/hydrogen exchanger 9 OS=Homo sapiens GN=SLC9A9 PE=1 SV=1 86 471 4.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04121|NHX1_YEAST Endosomal/prevacuolar sodium/hydrogen exchanger OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHX1 PE=1 SV=1 19 598 0.0E+00
sp|O13726|YDO6_SCHPO Uncharacterized Na(+)/H(+) antiporter C15A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15A10.06 PE=1 SV=3 30 472 1.0E-176
sp|Q92581|SL9A6_HUMAN Sodium/hydrogen exchanger 6 OS=Homo sapiens GN=SLC9A6 PE=1 SV=2 57 583 3.0E-83
sp|Q8BZ00|SL9A9_MOUSE Sodium/hydrogen exchanger 9 OS=Mus musculus GN=Slc9a9 PE=2 SV=1 86 466 4.0E-83
sp|Q8IVB4|SL9A9_HUMAN Sodium/hydrogen exchanger 9 OS=Homo sapiens GN=SLC9A9 PE=1 SV=1 86 471 4.0E-81
sp|Q8BLV3|SL9A7_MOUSE Sodium/hydrogen exchanger 7 OS=Mus musculus GN=Slc9a7 PE=1 SV=1 84 472 3.0E-78
sp|Q96T83|SL9A7_HUMAN Sodium/hydrogen exchanger 7 OS=Homo sapiens GN=SLC9A7 PE=1 SV=1 79 481 3.0E-76
sp|Q8RWU6|NHX6_ARATH Sodium/hydrogen exchanger 6 OS=Arabidopsis thaliana GN=NHX6 PE=1 SV=3 18 490 4.0E-71
sp|Q552S0|NHE1_DICDI Sodium/hydrogen exchanger 1 OS=Dictyostelium discoideum GN=nhe1 PE=2 SV=1 21 466 4.0E-65
sp|Q9Y2E8|SL9A8_HUMAN Sodium/hydrogen exchanger 8 OS=Homo sapiens GN=SLC9A8 PE=1 SV=4 25 471 1.0E-62
sp|Q8R4D1|SL9A8_MOUSE Sodium/hydrogen exchanger 8 OS=Mus musculus GN=Slc9a8 PE=1 SV=1 25 460 1.0E-62
sp|Q4L208|SL9A8_RAT Sodium/hydrogen exchanger 8 OS=Rattus norvegicus GN=Slc9a8 PE=2 SV=1 19 460 1.0E-62
sp|Q5ZJ75|SL9A8_CHICK Sodium/hydrogen exchanger 8 OS=Gallus gallus PE=2 SV=1 28 471 1.0E-62
sp|Q8S396|NHX5_ARATH Sodium/hydrogen exchanger 5 OS=Arabidopsis thaliana GN=NHX5 PE=2 SV=2 18 468 1.0E-59
sp|Q8S397|NHX4_ARATH Sodium/hydrogen exchanger 4 OS=Arabidopsis thaliana GN=NHX4 PE=2 SV=2 39 457 8.0E-53
sp|Q01345|NHEB_ONCMY Na(+)/H(+) exchanger beta OS=Oncorhynchus mykiss PE=2 SV=1 65 499 8.0E-48
sp|P48763|SL9A2_RAT Sodium/hydrogen exchanger 2 OS=Rattus norvegicus GN=Slc9a2 PE=1 SV=1 42 460 1.0E-47
sp|P50482|SL9A2_RABIT Sodium/hydrogen exchanger 2 OS=Oryctolagus cuniculus GN=SLC9A2 PE=2 SV=1 42 460 1.0E-47
sp|Q4R8V4|SL9A8_MACFA Sodium/hydrogen exchanger 8 OS=Macaca fascicularis GN=SLC9A8 PE=2 SV=1 25 471 3.0E-47
sp|Q56XP4|NHX2_ARATH Sodium/hydrogen exchanger 2 OS=Arabidopsis thaliana GN=NHX2 PE=2 SV=2 44 454 2.0E-46
sp|Q9UBY0|SL9A2_HUMAN Sodium/hydrogen exchanger 2 OS=Homo sapiens GN=SLC9A2 PE=2 SV=1 42 460 3.0E-46
sp|Q84WG1|NHX3_ARATH Sodium/hydrogen exchanger 3 OS=Arabidopsis thaliana GN=NHX3 PE=2 SV=2 44 447 8.0E-46
sp|Q68KI4|NHX1_ARATH Sodium/hydrogen exchanger 1 OS=Arabidopsis thaliana GN=NHX1 PE=1 SV=2 13 472 1.0E-45
sp|P26432|SL9A3_RABIT Sodium/hydrogen exchanger 3 OS=Oryctolagus cuniculus GN=SLC9A3 PE=1 SV=1 100 460 7.0E-44
sp|P48764|SL9A3_HUMAN Sodium/hydrogen exchanger 3 OS=Homo sapiens GN=SLC9A3 PE=1 SV=2 100 460 3.0E-43
sp|Q6AI14|SL9A4_HUMAN Sodium/hydrogen exchanger 4 OS=Homo sapiens GN=SLC9A4 PE=1 SV=2 67 507 4.0E-43
sp|M5A7P9|SL9A3_TRISC Sodium/hydrogen exchanger 3 OS=Triakis scyllium GN=slc9a3 PE=1 SV=1 100 460 2.0E-42
sp|G3X939|SL9A3_MOUSE Sodium/hydrogen exchanger 3 OS=Mus musculus GN=Slc9a3 PE=1 SV=1 100 460 3.0E-42
sp|Q8BUE1|SL9A4_MOUSE Sodium/hydrogen exchanger 4 OS=Mus musculus GN=Slc9a4 PE=2 SV=1 18 470 6.0E-42
sp|P26434|SL9A4_RAT Sodium/hydrogen exchanger 4 OS=Rattus norvegicus GN=Slc9a4 PE=1 SV=1 67 507 1.0E-41
sp|Q28362|SL9A3_DIDVI Sodium/hydrogen exchanger 3 OS=Didelphis virginiana GN=SLC9A3 PE=1 SV=1 100 460 1.0E-41
sp|P26433|SL9A3_RAT Sodium/hydrogen exchanger 3 OS=Rattus norvegicus GN=Slc9a3 PE=1 SV=1 100 460 2.0E-41
sp|P48762|SL9A1_PIG Sodium/hydrogen exchanger 1 OS=Sus scrofa GN=SLC9A1 PE=2 SV=1 42 502 1.0E-39
sp|Q61165|SL9A1_MOUSE Sodium/hydrogen exchanger 1 OS=Mus musculus GN=Slc9a1 PE=1 SV=1 42 502 3.0E-39
sp|P26431|SL9A1_RAT Sodium/hydrogen exchanger 1 OS=Rattus norvegicus GN=Slc9a1 PE=1 SV=2 42 502 4.0E-39
sp|P19634|SL9A1_HUMAN Sodium/hydrogen exchanger 1 OS=Homo sapiens GN=SLC9A1 PE=1 SV=2 42 502 5.0E-39
sp|Q28036|SL9A1_BOVIN Sodium/hydrogen exchanger 1 OS=Bos taurus GN=SLC9A1 PE=2 SV=1 65 502 1.0E-38
sp|Q14940|SL9A5_HUMAN Sodium/hydrogen exchanger 5 OS=Homo sapiens GN=SLC9A5 PE=1 SV=2 97 423 1.0E-38
sp|P23791|SL9A1_RABIT Sodium/hydrogen exchanger 1 OS=Oryctolagus cuniculus GN=SLC9A1 PE=2 SV=1 42 502 4.0E-38
sp|G5EBK1|PBO4_CAEEL Na(+)/H(+) exchanger protein 7 OS=Caenorhabditis elegans GN=pbo-4 PE=1 SV=1 67 460 6.0E-38
sp|Q9Z0X2|SL9A5_RAT Sodium/hydrogen exchanger 5 OS=Rattus norvegicus GN=Slc9a5 PE=1 SV=1 97 423 1.0E-37
sp|Q8T5S1|NHX2_CAEEL Na(+)/H(+) exchanger protein 2 OS=Caenorhabditis elegans GN=nhx-2 PE=2 SV=1 91 632 1.0E-35
sp|P48761|SL9A1_CRIGR Sodium/hydrogen exchanger 1 OS=Cricetulus griseus GN=SLC9A1 PE=2 SV=1 42 502 2.0E-33
sp|P35449|NHX9_CAEEL Probable Na(+)/H(+) antiporter nhx-9 OS=Caenorhabditis elegans GN=nhx-9 PE=2 SV=2 42 460 9.0E-32
sp|O16452|NHX3_CAEEL Probable Na(+)/H(+) antiporter nhx-3 OS=Caenorhabditis elegans GN=nhx-3 PE=2 SV=2 20 460 2.0E-26
sp|Q2XWL3|NHAH_HALDA Na(+)/H(+) antiporter NhaH OS=Halobacillus dabanensis GN=nhaH PE=1 SV=1 103 459 2.0E-23
sp|Q93HU4|NHAP_APHHA Na(+)/H(+) antiporter ApNhaP OS=Aphanothece halophytica GN=apnhaP PE=1 SV=1 93 459 1.0E-21
sp|B0LJC9|NHAH_HALAD Na(+)/H(+) antiporter NhaH OS=Halobacillus aidingensis GN=nhaH PE=1 SV=1 103 459 4.0E-21
sp|Q9LCB5|NHAG_BACAT Na(+)/H(+) antiporter NhaG OS=Bacillus atrophaeus GN=nhaG PE=1 SV=1 72 481 5.0E-17
sp|P73863|NHAS1_SYNY3 Low-affinity Na(+)/H(+) antiporter NhaS1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nhaS1 PE=1 SV=1 92 455 5.0E-16
sp|Q9LKW9|NHX7_ARATH Sodium/hydrogen exchanger 7 OS=Arabidopsis thaliana GN=NHX7 PE=1 SV=1 87 457 2.0E-15
sp|Q3YL57|NHX8_ARATH Sodium/hydrogen exchanger 8 OS=Arabidopsis thaliana GN=NHX8 PE=2 SV=1 87 461 9.0E-12
sp|G3XD29|NHAP_PSEAE Na(+)/H(+) antiporter NhaP OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nhaP PE=1 SV=1 99 450 3.0E-08
sp|P32703|YJCE_ECOLI Uncharacterized Na(+)/H(+) exchanger YjcE OS=Escherichia coli (strain K12) GN=yjcE PE=3 SV=1 94 344 4.0E-08
sp|A4WBF0|NHAP2_ENT38 K(+)/H(+) antiporter NhaP2 OS=Enterobacter sp. (strain 638) GN=nhaP2 PE=3 SV=1 103 450 7.0E-08
sp|B5R8Z9|NHAP2_SALG2 K(+)/H(+) antiporter NhaP2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|B5F4E6|NHAP2_SALA4 K(+)/H(+) antiporter NhaP2 OS=Salmonella agona (strain SL483) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|Q57NL1|NHAP2_SALCH K(+)/H(+) antiporter NhaP2 OS=Salmonella choleraesuis (strain SC-B67) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|B5FTN3|NHAP2_SALDC K(+)/H(+) antiporter NhaP2 OS=Salmonella dublin (strain CT_02021853) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|B5BI52|NHAP2_SALPK K(+)/H(+) antiporter NhaP2 OS=Salmonella paratyphi A (strain AKU_12601) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|B5R2W9|NHAP2_SALEP K(+)/H(+) antiporter NhaP2 OS=Salmonella enteritidis PT4 (strain P125109) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|B4SUJ3|NHAP2_SALNS K(+)/H(+) antiporter NhaP2 OS=Salmonella newport (strain SL254) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|Q5PN10|NHAP2_SALPA K(+)/H(+) antiporter NhaP2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|A9MVW9|NHAP2_SALPB K(+)/H(+) antiporter NhaP2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|C0Q332|NHAP2_SALPC K(+)/H(+) antiporter NhaP2 OS=Salmonella paratyphi C (strain RKS4594) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|B4TXX1|NHAP2_SALSV K(+)/H(+) antiporter NhaP2 OS=Salmonella schwarzengrund (strain CVM19633) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|P65525|NHAP2_SALTI K(+)/H(+) antiporter NhaP2 OS=Salmonella typhi GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|P65524|NHAP2_SALTY K(+)/H(+) antiporter NhaP2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|B4TKD1|NHAP2_SALHS K(+)/H(+) antiporter NhaP2 OS=Salmonella heidelberg (strain SL476) GN=nhaP2 PE=3 SV=1 103 450 1.0E-07
sp|A8FHE3|NHAK_BACP2 Sodium, potassium, lithium and rubidium/H(+) antiporter OS=Bacillus pumilus (strain SAFR-032) GN=nhaK PE=3 SV=1 94 418 3.0E-07
sp|Q48P74|NHAP2_PSE14 K(+)/H(+) antiporter NhaP2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nhaP2 PE=3 SV=2 103 456 3.0E-07
sp|Q87VB6|NHAP2_PSESM K(+)/H(+) antiporter NhaP2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nhaP2 PE=3 SV=2 103 456 3.0E-07
sp|C3LSD1|NHAP2_VIBCM K(+)/H(+) antiporter NhaP2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=nhaP2 PE=3 SV=1 94 475 5.0E-07
sp|Q9KNM9|NHAP2_VIBCH K(+)/H(+) antiporter NhaP2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nhaP2 PE=3 SV=1 94 475 5.0E-07
sp|A5F4U3|NHAP2_VIBC3 K(+)/H(+) antiporter NhaP2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=nhaP2 PE=1 SV=1 94 475 1.0E-06
sp|A7Z8R4|NHAK_BACMF Sodium, potassium, lithium and rubidium/H(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=nhaK PE=3 SV=1 95 373 2.0E-06
sp|Q87KV8|NHAP2_VIBPA K(+)/H(+) antiporter NhaP2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=nhaP2 PE=1 SV=1 88 475 4.0E-06
sp|O32212|NHAK_BACSU Sodium, potassium, lithium and rubidium/H(+) antiporter OS=Bacillus subtilis (strain 168) GN=nhaK PE=1 SV=1 95 304 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006812 cation transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0015297 antiporter activity No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0015298 solute:cation antiporter activity No
GO:0005575 cellular_component No
GO:0015291 secondary active transmembrane transporter activity No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 63 85 22
3 100 117 17
4 130 152 22
5 162 184 22
6 238 260 22
7 289 311 22
8 324 346 22
9 356 378 22
10 429 451 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5915
MLSPARVAGMDLSLFARAPDESDPEEGDSAQKELFAAWALFISIMLLIAAFFTSYMLQMKKVTAVHETVISIFAG
MIVGLVLLVTSGDSIRNLISFDYQIFFNLLLPPIILSSGYELHQANFFRNIGTILTFAFAGTFLSAVVIGLILWL
FALIPGSLQMTFVDAISVGATLSATDPVTILAIFNTYKVDPKLYTIIFGESILNDAIAIVIFETAQKYNKGVAGR
LGIISFFEGTGIFLLVFFCSLLIGVIVGVGTALLLKFTYLRRLPKIESCLIVLISYATYFFSHGVHMSGIVSLLF
CGITLKHYAYFNMSRRTQLTTKYLFQVISQLSENFIFIYLGLALFTDNALQFQPPLIIVTVLAVCAARWVAVFPL
SRAINWVIRYRARRRGFEVNDELPYNYQAMLFWAGLRGAVGVALAALLTGENSYALRATVLVVVVLTVIIFGGTT
ARMLEILGIRTGVVDEIDSDDEFDIETLGVGFHAKRSSGMAGGYHHQRRNGNVALDNLEGNSATYVSGHSTSPLP
PGGRPHSVSRKNSSVRSLDDADSDRADLLLGRAPPDDSDLASDLDTADLPPPARRSPRLPSVSGSRSSLPSHYQP
PQVDSAFMSPTSDGPTAPITATGAIRQLFSAEDPAGLFRQLDEDFIKPRLLLHGDGSRGGGGGGAGGGAGPG
Coding >Ophio5|5915
ATGCTGTCTCCCGCACGCGTCGCCGGCATGGACCTCAGCCTCTTTGCTCGTGCGCCCGATGAGTCGGATCCTGAG
GAGGGAGACTCGGCGCAAAAGGAGCTCTTCGCCGCTTGGGCTCTCTTTATTTCTATCATGCTGCTCATCGCCGCC
TTCTTCACCAGCTACATGCTTCAGATGAAAAAGGTCACTGCCGTTCACGAGACCGTCATCTCCATCTTCGCCGGC
ATGATTGTCGGCCTCGTACTCCTCGTCACCTCGGGCGACTCGATCCGAAACCTCATCAGCTTCGACTACCAAATC
TTCTTCAACCTCCTCCTCCCACCCATCATCCTCTCTTCGGGCTACGAGCTACACCAGGCCAACTTCTTCCGAAAC
ATCGGCACTATCCTCACCTTCGCCTTTGCCGGCACTTTCCTCTCTGCCGTCGTCATCGGCCTCATCCTATGGCTC
TTTGCCCTCATCCCGGGCTCCCTGCAGATGACCTTTGTCGACGCCATTTCCGTTGGCGCCACCCTCTCCGCCACC
GATCCCGTCACCATACTGGCCATCTTCAATACCTACAAGGTCGATCCCAAGCTCTACACCATCATTTTTGGCGAA
TCCATCCTCAACGACGCCATTGCCATTGTCATCTTCGAGACGGCCCAAAAGTACAACAAGGGCGTCGCCGGCCGC
TTGGGCATCATCAGCTTCTTCGAGGGTACGGGCATCTTTTTGCTCGTCTTCTTTTGCAGCCTGCTCATCGGCGTC
ATCGTCGGCGTCGGCACCGCCCTGCTTCTCAAGTTCACCTACCTGAGAAGGCTGCCCAAGATCGAGAGCTGCCTG
ATTGTCCTGATATCTTATGCCACCTACTTTTTCTCCCATGGCGTGCACATGTCTGGCATCGTGTCGTTGCTCTTC
TGCGGCATCACGCTCAAGCACTACGCCTACTTTAACATGTCGAGACGCACCCAGCTCACGACTAAATACCTGTTC
CAGGTTATCTCGCAGCTGTCGGAAAACTTCATCTTCATCTACCTCGGCCTGGCCCTCTTCACCGACAACGCGCTC
CAGTTCCAGCCGCCGCTCATCATCGTCACGGTCCTGGCCGTCTGCGCCGCCCGCTGGGTGGCCGTCTTCCCCCTG
TCGAGGGCCATCAACTGGGTCATCCGGTACCGCGCCCGTCGTAGGGGCTTCGAGGTCAACGACGAGCTCCCCTAC
AACTACCAGGCCATGCTCTTCTGGGCCGGTCTGCGGGGGGCCGTCGGAGTCGCGCTGGCGGCCCTGCTCACGGGA
GAGAACTCGTACGCGCTGAGGGCCACGGTCCTCGTCGTCGTCGTCCTCACCGTCATCATCTTCGGCGGCACCACG
GCCCGTATGCTGGAGATTCTCGGCATCCGCACCGGCGTCGTCGACGAGATCGACAGTGACGACGAGTTCGACATT
GAGACGCTCGGCGTCGGCTTCCACGCTAAACGCTCCTCGGGCATGGCTGGCGGCTATCACCACCAGCGCCGTAAC
GGCAACGTCGCCCTTGACAATCTCGAGGGCAACTCGGCCACCTACGTCTCGGGCCATTCCACCTCGCCGCTGCCC
CCCGGCGGCCGTCCTCACAGCGTCAGCCGCAAGAATTCGTCGGTCCGCAGCCTCGACGACGCAGACTCGGACCGG
GCCGACCTCCTCCTCGGCCGCGCCCCGCCCGACGACTCGGACCTGGCCTCGGACCTCGACACGGCGGACCTCCCA
CCTCCGGCCCGTCGCTCGCCGCGCCTTCCGTCCGTCTCCGGCAGCCGGTCATCGCTGCCGTCGCATTATCAGCCG
CCCCAGGTCGACAGCGCCTTCATGAGCCCCACGAGCGACGGCCCTACGGCGCCCATCACCGCTACGGGCGCCATC
CGCCAGCTCTTTAGCGCGGAAGACCCCGCCGGTCTCTTCCGACAGCTGGACGAGGACTTTATCAAGCCGCGTCTG
CTCCTTCATGGCGATGGGTCCAGAGGCGGCGGCGGCGGGGGGGCCGGTGGAGGCGCCGGACCTGGT
Transcript >Ophio5|5915
ATGCTGTCTCCCGCACGCGTCGCCGGCATGGACCTCAGCCTCTTTGCTCGTGCGCCCGATGAGTCGGATCCTGAG
GAGGGAGACTCGGCGCAAAAGGAGCTCTTCGCCGCTTGGGCTCTCTTTATTTCTATCATGCTGCTCATCGCCGCC
TTCTTCACCAGCTACATGCTTCAGATGAAAAAGGTCACTGCCGTTCACGAGACCGTCATCTCCATCTTCGCCGGC
ATGATTGTCGGCCTCGTACTCCTCGTCACCTCGGGCGACTCGATCCGAAACCTCATCAGCTTCGACTACCAAATC
TTCTTCAACCTCCTCCTCCCACCCATCATCCTCTCTTCGGGCTACGAGCTACACCAGGCCAACTTCTTCCGAAAC
ATCGGCACTATCCTCACCTTCGCCTTTGCCGGCACTTTCCTCTCTGCCGTCGTCATCGGCCTCATCCTATGGCTC
TTTGCCCTCATCCCGGGCTCCCTGCAGATGACCTTTGTCGACGCCATTTCCGTTGGCGCCACCCTCTCCGCCACC
GATCCCGTCACCATACTGGCCATCTTCAATACCTACAAGGTCGATCCCAAGCTCTACACCATCATTTTTGGCGAA
TCCATCCTCAACGACGCCATTGCCATTGTCATCTTCGAGACGGCCCAAAAGTACAACAAGGGCGTCGCCGGCCGC
TTGGGCATCATCAGCTTCTTCGAGGGTACGGGCATCTTTTTGCTCGTCTTCTTTTGCAGCCTGCTCATCGGCGTC
ATCGTCGGCGTCGGCACCGCCCTGCTTCTCAAGTTCACCTACCTGAGAAGGCTGCCCAAGATCGAGAGCTGCCTG
ATTGTCCTGATATCTTATGCCACCTACTTTTTCTCCCATGGCGTGCACATGTCTGGCATCGTGTCGTTGCTCTTC
TGCGGCATCACGCTCAAGCACTACGCCTACTTTAACATGTCGAGACGCACCCAGCTCACGACTAAATACCTGTTC
CAGGTTATCTCGCAGCTGTCGGAAAACTTCATCTTCATCTACCTCGGCCTGGCCCTCTTCACCGACAACGCGCTC
CAGTTCCAGCCGCCGCTCATCATCGTCACGGTCCTGGCCGTCTGCGCCGCCCGCTGGGTGGCCGTCTTCCCCCTG
TCGAGGGCCATCAACTGGGTCATCCGGTACCGCGCCCGTCGTAGGGGCTTCGAGGTCAACGACGAGCTCCCCTAC
AACTACCAGGCCATGCTCTTCTGGGCCGGTCTGCGGGGGGCCGTCGGAGTCGCGCTGGCGGCCCTGCTCACGGGA
GAGAACTCGTACGCGCTGAGGGCCACGGTCCTCGTCGTCGTCGTCCTCACCGTCATCATCTTCGGCGGCACCACG
GCCCGTATGCTGGAGATTCTCGGCATCCGCACCGGCGTCGTCGACGAGATCGACAGTGACGACGAGTTCGACATT
GAGACGCTCGGCGTCGGCTTCCACGCTAAACGCTCCTCGGGCATGGCTGGCGGCTATCACCACCAGCGCCGTAAC
GGCAACGTCGCCCTTGACAATCTCGAGGGCAACTCGGCCACCTACGTCTCGGGCCATTCCACCTCGCCGCTGCCC
CCCGGCGGCCGTCCTCACAGCGTCAGCCGCAAGAATTCGTCGGTCCGCAGCCTCGACGACGCAGACTCGGACCGG
GCCGACCTCCTCCTCGGCCGCGCCCCGCCCGACGACTCGGACCTGGCCTCGGACCTCGACACGGCGGACCTCCCA
CCTCCGGCCCGTCGCTCGCCGCGCCTTCCGTCCGTCTCCGGCAGCCGGTCATCGCTGCCGTCGCATTATCAGCCG
CCCCAGGTCGACAGCGCCTTCATGAGCCCCACGAGCGACGGCCCTACGGCGCCCATCACCGCTACGGGCGCCATC
CGCCAGCTCTTTAGCGCGGAAGACCCCGCCGGTCTCTTCCGACAGCTGGACGAGGACTTTATCAAGCCGCGTCTG
CTCCTTCATGGCGATGGGTCCAGAGGCGGCGGCGGCGGGGGGGCCGGTGGAGGCGCCGGACCTGGTTGA
Gene >Ophio5|5915
ATGCTGTCTCCCGCACGCGTCGCCGGCATGGACCTCAGCCTCTTTGCTCGTGCGCCCGATGAGTCGGATCCTGAG
GGTGCGCGACTCCCATCTTCGGCTTTCCGTTGATGCGCGTTGCTGACGTTGGCTTCATCTTTCAGAGGGAGACTC
GGCGCAAAAGGAGCTCTTCGCCGCTTGGGCTCTCTTTATTTCTATCATGCTGCTCATCGCCGCCTTCTTCACCAG
CTACATGCTTCAGATGAAAAAGGTCACTGCCGTTCACGAGACCGTCATCTCCATCTTCGCCGGTGCTCCTCTCCC
TCTTTTCCTCTCTCCTTTCTCTCTTGATCCCTCTTTCCCGCCCCATCCCATCACTCCAATACTGACTCTTCCGTC
CCCTCCCCCAGGCATGATTGTCGGCCTCGTACTCCTCGTCACCTCGGGCGACTCGATCCGAAACCTCATCAGCTT
CGACTACCAAATCTTCTTCAACCTCCTCCTCCCACCCATCATCCTCTCTTCGGGCTACGAGCTACACCAGGCCAA
CTTCTTCCGAAACATCGGCACTATCCTCACCTTCGCCTTTGCCGGCACTTTCCTCTCTGCCGTCGTCATCGGCCT
CATCCTATGGCTCTTTGCCCTCATCCCGGGCTCCCTGCAGATGACCTTTGTCGACGCCATTTCCGTTGGCGCCAC
CCTCTCCGCCACCGATCCCGTCACCATACTGGCCATCTTCAATACCTACAAGGTCGATCCCAAGCTCTACACCAT
CATTTTTGGCGAATCCATCCTCAACGACGCCATTGCCATTGTCATCTTCGAGACGGCCCAAAAGTACAACAAGGG
CGTCGCCGGCCGCTTGGGCATCATCAGCTTCTTCGAGGGTACGGGCATCTTTTTGCTCGTCTTCTTTTGCAGCCT
GCTCATCGGCGTCATCGTCGGCGTCGGCACCGCCCTGCTTCTCAAGTTCACCTACCTGAGAAGGCTGCCCAAGAT
CGAGAGCTGCCTGATTGTCCTGATATCTTATGCCACCTACTTTTTCTCCCATGGCGTGCACATGTCTGGTACGTC
GTCGTCGTCCCCCCCCCCCCCCCTTTTCCGGGCCTCTCTGACTGACACGCCCAAGGCATCGTGTCGTTGCTCTTC
TGCGGCATCACGCTCAAGCACTACGCCTACTTTAACATGTCGAGACGCACCCAGCTCACGACTAAATACCTGTTC
CAGGTTATCTCGCAGCTGTCGGAAAACTTCATCTTCATCTACCTCGGCCTGGCCCTCTTCACCGACAACGCGCTC
CAGTTCCAGCCGCCGCTCATCATCGTCACGGTCCTGGCCGTCTGCGCCGCCCGCTGGGTGGCCGTCTTCCCCCTG
TCGAGGGCCATCAACTGGGTCATCCGGTACCGCGCCCGTCGTAGGGGCTTCGAGGTCAACGACGAGCTCCCCTAC
AACTACCAGGCCATGCTCTTCTGGGCCGGTCTGCGGGGGGCCGTCGGAGTCGCGCTGGCGGCCCTGCTCACGGGA
GAGAACTCGTACGCGCTGAGGGCCACGGTCCTCGTCGTCGTCGTCCTCACCGTCATCATCTTCGGCGGCACCACG
GCCCGTATGCTGGAGATTCTCGGCATCCGCACCGGCGTCGTCGACGAGATCGACAGTGACGACGAGTTCGACATT
GAGACGCTCGGCGTCGGCTTCCACGCTAAACGCTCCTCGGGCATGGCTGGCGGCTATCACCACCAGCGCCGTAAC
GGCAACGTCGCCCTTGACAATCTCGAGGGCAACTCGGCCACCTACGTCTCGGGCCATTCCACCTCGCCGCTGCCC
CCCGGCGGCCGTCCTCACAGCGTCAGCCGCAAGAATTCGTCGGTCCGCAGCCTCGACGACGCAGACTCGGACCGG
GCCGACCTCCTCCTCGGCCGCGCCCCGCCCGACGACTCGGACCTGGCCTCGGACCTCGACACGGCGGACCTCCCA
CCTCCGGCCCGTCGCTCGCCGCGCCTTCCGTCCGTCTCCGGCAGCCGGTCATCGCTGCCGTCGCATTATCAGCCG
CCCCAGGTCGACAGCGCCTTCATGAGCCCCACGAGCGACGGCCCTACGGCGCCCATCACCGCTACGGGCGCCATC
CGCCAGCTCTTTAGCGCGGAAGACCCCGCCGGTCTCTTCCGACAGCTGGACGAGGACTTTATCAAGCCGCGTCTG
CTCCTTCATGGCGATGGGTCCAGAGGCGGCGGCGGCGGGGGGGCCGGTGGAGGCGCCGGACCTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail