Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5911
Gene name
Locationscaffold_5:33878..37319
Strand+
Gene length (bp)3441
Transcript length (bp)3381
Coding sequence length (bp)3378
Protein length (aa) 1126

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18136 DNApol_Exo DNA mitochondrial polymerase exonuclease domain 7.4E-103 108 386
PF00476 DNA_pol_A DNA polymerase family A 5.5E-36 589 960

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y767|DPOG_NEUCR DNA polymerase gamma, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mip-1 PE=3 SV=2 5 1065 0.0E+00
sp|Q12704|DPOG_SCHPO DNA polymerase gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mip1 PE=3 SV=2 56 1046 0.0E+00
sp|Q01941|DPOG_PICPA DNA polymerase gamma OS=Komagataella pastoris GN=MIP1 PE=3 SV=1 53 1038 0.0E+00
sp|P15801|DPOG_YEAST DNA polymerase gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIP1 PE=1 SV=3 22 1035 0.0E+00
sp|Q27607|DPOG1_DROME DNA polymerase subunit gamma-1, mitochondrial OS=Drosophila melanogaster GN=tam PE=1 SV=2 58 1001 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y767|DPOG_NEUCR DNA polymerase gamma, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mip-1 PE=3 SV=2 5 1065 0.0E+00
sp|Q12704|DPOG_SCHPO DNA polymerase gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mip1 PE=3 SV=2 56 1046 0.0E+00
sp|Q01941|DPOG_PICPA DNA polymerase gamma OS=Komagataella pastoris GN=MIP1 PE=3 SV=1 53 1038 0.0E+00
sp|P15801|DPOG_YEAST DNA polymerase gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIP1 PE=1 SV=3 22 1035 0.0E+00
sp|Q27607|DPOG1_DROME DNA polymerase subunit gamma-1, mitochondrial OS=Drosophila melanogaster GN=tam PE=1 SV=2 58 1001 0.0E+00
sp|Q92076|DPOG1_CHICK DNA polymerase subunit gamma-1 (Fragment) OS=Gallus gallus GN=POLG PE=2 SV=1 572 999 8.0E-135
sp|Q9QYV8|DPOG1_RAT DNA polymerase subunit gamma-1 OS=Rattus norvegicus GN=Polg PE=2 SV=1 572 999 4.0E-130
sp|P54099|DPOG1_MOUSE DNA polymerase subunit gamma-1 OS=Mus musculus GN=Polg PE=1 SV=3 572 999 2.0E-129
sp|Q91684|DPOG1_XENLA DNA polymerase subunit gamma-1 OS=Xenopus laevis GN=polg PE=2 SV=1 572 998 2.0E-129
sp|P54098|DPOG1_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens GN=POLG PE=1 SV=1 572 999 2.0E-128
sp|P54098|DPOG1_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens GN=POLG PE=1 SV=1 54 565 2.0E-74
sp|Q91684|DPOG1_XENLA DNA polymerase subunit gamma-1 OS=Xenopus laevis GN=polg PE=2 SV=1 15 539 8.0E-74
sp|Q9QYV8|DPOG1_RAT DNA polymerase subunit gamma-1 OS=Rattus norvegicus GN=Polg PE=2 SV=1 54 539 5.0E-69
sp|P54099|DPOG1_MOUSE DNA polymerase subunit gamma-1 OS=Mus musculus GN=Polg PE=1 SV=3 52 539 1.0E-67
sp|O67779|DPO1_AQUAE DNA polymerase I OS=Aquifex aeolicus (strain VF5) GN=polA PE=3 SV=1 642 917 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0003677 DNA binding Yes
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0140097 catalytic activity, acting on DNA No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016740 transferase activity No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0006259 DNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034061 DNA polymerase activity No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5911
MYIFPGRSQYVAATGLAFVGRLRTSRRFALRPQLRWLAKAATLESRGSLAVTSQPRFNEIGVQQLSAHVFNQIFP
NGCQPAPKELVDLSREHLRRHDLLGKTADNSEPIAFDLPPLQGRTLDEHFYRLGKDCAEPYLTLAKQFANAKLPE
KPTSWLRQSGWTKYYPDGRTEAVDTPDDVMLCFDTETLYKESPFSVMACAASPGAWFVWLSPWLLGKSESDRHLI
PLGDPTQARVIVGHNVGYDRARVLEEYNVKQSRNAFLDTMSFHVAVNGMCSQQRPTWLKHKKNRELRERVAAETP
DHELAELLSGDGMNEEEELWVERSSINSLRDVAKFHLDVTMDKTVRDDFGTLDRDGVLAKLDELLEYCATDVSIT
HSIYKIVFPNFLTVCPHPVSFAALRHLTSVILPVNRSWDDYIANAEEKYRQLSSAVHERLIGLTEKALALKDDAT
QWESDPWLNQLDWSGQEIRMIKGKKKGDPPRPARQKKPGMPRWYKDLFAKSDSPLNITVRTRIAPLLLKMSWDGN
PLFWSTKYGWTFRVSKDQTAKYTAKQMIECEFDKEDALLRDDLDHAYIKLPHKDGPTARCANVLAKGYLPYFENG
TLSSAYTYAKEALEMNASCSYWISARDRIRGQLVVYENELSLSQIKGKGKRGRKKLMTNENGFILPQIIPMGTIT
RRAVENTWLTASNAKKNRVGSELKAMIKAPAGYCFVGADVDSQELWIASLVGDATFKIHGGNAVGFMTLEGTKAA
GTDLHSRTAGILGISRNDAKVFNYGRIYGAGLKFAATLLRQFNPSLTEKETTDTASKLYANTKGTKTNRKSLHQR
PFWRGGTESLVFNKLEEFAEQERPRTPVLGAGITEALMARYISKGGYLTSRINWAIQSSGVDYLHLLIVSMNYLV
TRYGIDARLAITVHDEIRYLVKTEDRYRAALALQVANVWTRAMFAQQVGIDDLPQSCAYFSAVDIDHVLRKEVDM
ECVTPSHPTPIAPGESLDIKTLLDKGQEATLGPVVVDDAAKLQRIEYVPRVAVMETMRKTSGDSIAFIKAQVADE
LELRDLVRRAKPASPKDYTRYNKSQFARQPYPHLIPKETLPVTEAMESTYRSGSNGLNRWPWSNNAAKGPRTASR
I
Coding >Ophio5|5911
ATGTACATCTTCCCTGGCCGATCTCAATATGTCGCCGCGACTGGCCTCGCTTTCGTCGGTCGCCTCCGGACTTCC
CGTCGCTTTGCGTTGAGGCCGCAGTTGCGATGGCTAGCCAAGGCCGCGACTCTGGAAAGCCGCGGCAGTCTTGCA
GTTACTTCGCAGCCGCGCTTCAACGAGATTGGTGTGCAGCAGTTGAGCGCCCATGTGTTCAACCAGATCTTCCCC
AATGGCTGCCAGCCGGCGCCAAAAGAGCTGGTAGATCTTTCGAGAGAGCACCTGCGCCGACATGACCTCCTTGGC
AAGACCGCCGACAACTCGGAACCGATTGCATTTGACCTGCCTCCGCTTCAGGGCCGCACTCTGGACGAACACTTT
TACAGGCTTGGCAAAGACTGTGCAGAGCCGTATCTGACGCTGGCGAAGCAATTTGCGAATGCCAAACTTCCGGAG
AAACCCACCAGTTGGCTGCGACAAAGTGGCTGGACCAAATATTACCCGGACGGGCGGACAGAGGCCGTCGATACG
CCCGACGACGTCATGCTCTGTTTTGACACCGAGACACTATATAAGGAGAGCCCCTTCTCGGTCATGGCTTGTGCG
GCAAGCCCTGGCGCCTGGTTCGTCTGGTTGTCGCCCTGGTTGCTTGGCAAGTCAGAATCCGATAGACATTTGATA
CCTCTCGGCGACCCTACCCAAGCACGGGTCATCGTGGGCCACAACGTTGGCTACGACCGAGCGAGAGTCCTTGAA
GAGTACAACGTGAAGCAGTCTCGAAATGCTTTCCTCGATACCATGTCTTTCCATGTCGCCGTCAACGGCATGTGC
TCGCAACAACGACCGACTTGGTTGAAGCACAAAAAAAACCGTGAATTGAGAGAGAGAGTGGCCGCTGAGACGCCA
GATCACGAACTTGCCGAGCTGCTCAGTGGCGATGGCATGAACGAAGAGGAGGAGCTGTGGGTGGAGAGAAGCTCA
ATCAACTCGCTGCGGGATGTCGCCAAGTTTCATCTCGACGTGACCATGGACAAGACGGTGCGAGACGACTTTGGG
ACCCTCGACCGTGATGGCGTCTTGGCCAAGCTCGACGAGCTGTTAGAGTACTGTGCAACGGATGTCTCCATCACG
CACAGCATCTACAAGATCGTCTTCCCCAACTTTCTCACCGTTTGTCCGCACCCGGTCAGTTTTGCTGCGCTGAGG
CATCTCACTTCTGTCATTCTTCCGGTCAACCGATCCTGGGATGACTACATCGCCAATGCAGAGGAAAAGTATCGT
CAGCTCTCTTCAGCCGTTCATGAACGGCTGATTGGCCTCACCGAGAAAGCACTTGCGTTGAAGGATGACGCGACT
CAGTGGGAGAGCGATCCTTGGCTGAATCAGCTCGATTGGTCCGGCCAGGAAATCCGCATGATCAAGGGCAAGAAA
AAAGGCGACCCTCCACGGCCAGCAAGGCAGAAGAAGCCGGGCATGCCCCGGTGGTACAAGGATCTGTTTGCCAAG
AGCGACTCGCCGCTGAATATTACTGTCAGAACCCGCATAGCGCCGCTGCTTCTGAAAATGTCGTGGGACGGCAAT
CCTCTTTTCTGGTCAACCAAGTACGGCTGGACGTTCCGAGTATCCAAAGATCAGACGGCAAAATATACGGCCAAG
CAGATGATCGAGTGTGAGTTCGACAAGGAAGACGCCCTTCTGCGGGACGACCTCGATCACGCCTACATTAAGCTC
CCACACAAGGACGGTCCTACTGCCCGCTGTGCGAATGTGCTCGCCAAGGGTTATCTGCCGTACTTTGAGAATGGG
ACCCTTTCCTCGGCGTATACCTACGCCAAAGAAGCGTTGGAGATGAACGCGTCTTGCTCTTACTGGATCAGCGCG
CGCGACCGTATCAGGGGCCAACTGGTTGTGTACGAAAACGAGCTGTCGCTGTCGCAAATCAAGGGCAAAGGCAAG
AGGGGCCGGAAGAAGCTGATGACCAACGAAAACGGCTTCATCCTGCCACAAATCATTCCCATGGGAACCATCACT
AGAAGGGCTGTGGAGAACACCTGGCTCACGGCGAGCAACGCCAAGAAGAATCGCGTGGGTTCGGAGCTAAAGGCC
ATGATCAAGGCCCCGGCAGGCTACTGCTTCGTCGGCGCCGACGTCGACTCTCAGGAACTGTGGATTGCCAGTCTT
GTGGGGGACGCAACGTTCAAGATCCACGGTGGCAATGCCGTCGGCTTCATGACGCTCGAAGGCACCAAGGCTGCC
GGCACGGACCTCCACTCGCGGACGGCGGGTATCTTGGGCATTTCGAGGAACGACGCCAAAGTCTTCAACTACGGG
CGCATCTACGGTGCGGGGCTCAAGTTCGCGGCGACGTTGCTACGGCAGTTCAATCCGTCCCTGACGGAAAAGGAG
ACGACGGACACGGCCTCGAAGCTGTACGCAAACACAAAAGGCACCAAGACCAACAGGAAATCGCTCCACCAGCGA
CCGTTTTGGCGAGGCGGGACCGAGTCTCTGGTCTTCAACAAGCTCGAGGAGTTCGCTGAGCAGGAGAGGCCGCGG
ACGCCGGTGCTGGGGGCCGGCATCACCGAGGCACTGATGGCCCGCTATATCAGCAAAGGTGGATATCTGACGTCT
CGCATCAACTGGGCGATCCAGTCGTCGGGCGTCGATTATCTTCACTTGTTGATCGTGTCAATGAACTACCTCGTC
ACGCGGTACGGCATCGACGCCCGACTGGCGATCACGGTGCACGACGAGATTCGTTACCTAGTGAAGACGGAAGAC
AGGTACAGAGCCGCACTGGCCCTACAAGTGGCCAATGTCTGGACAAGAGCCATGTTTGCGCAGCAGGTGGGTATA
GACGATCTGCCGCAGTCCTGCGCCTACTTTTCCGCCGTGGACATCGACCACGTGCTACGCAAGGAAGTGGATATG
GAGTGCGTGACGCCCAGTCATCCAACGCCGATTGCCCCGGGCGAGAGCTTGGACATCAAGACCCTGCTGGACAAG
GGACAAGAGGCGACACTGGGCCCGGTTGTCGTGGACGATGCTGCCAAGTTGCAACGCATAGAGTACGTCCCCCGT
GTGGCGGTGATGGAGACGATGCGAAAGACATCCGGGGATAGCATCGCCTTTATCAAGGCTCAAGTGGCCGACGAG
CTTGAGCTGCGAGACCTCGTCAGGCGTGCGAAGCCGGCGTCGCCCAAGGACTATACCAGGTACAACAAGTCGCAG
TTCGCTCGCCAGCCTTACCCTCACTTGATACCAAAGGAGACGCTACCGGTGACGGAGGCGATGGAGTCGACGTAT
CGGAGCGGAAGCAACGGCCTGAATCGTTGGCCTTGGTCCAACAATGCTGCCAAGGGGCCGCGGACTGCGTCGAGA
ATT
Transcript >Ophio5|5911
ATGTACATCTTCCCTGGCCGATCTCAATATGTCGCCGCGACTGGCCTCGCTTTCGTCGGTCGCCTCCGGACTTCC
CGTCGCTTTGCGTTGAGGCCGCAGTTGCGATGGCTAGCCAAGGCCGCGACTCTGGAAAGCCGCGGCAGTCTTGCA
GTTACTTCGCAGCCGCGCTTCAACGAGATTGGTGTGCAGCAGTTGAGCGCCCATGTGTTCAACCAGATCTTCCCC
AATGGCTGCCAGCCGGCGCCAAAAGAGCTGGTAGATCTTTCGAGAGAGCACCTGCGCCGACATGACCTCCTTGGC
AAGACCGCCGACAACTCGGAACCGATTGCATTTGACCTGCCTCCGCTTCAGGGCCGCACTCTGGACGAACACTTT
TACAGGCTTGGCAAAGACTGTGCAGAGCCGTATCTGACGCTGGCGAAGCAATTTGCGAATGCCAAACTTCCGGAG
AAACCCACCAGTTGGCTGCGACAAAGTGGCTGGACCAAATATTACCCGGACGGGCGGACAGAGGCCGTCGATACG
CCCGACGACGTCATGCTCTGTTTTGACACCGAGACACTATATAAGGAGAGCCCCTTCTCGGTCATGGCTTGTGCG
GCAAGCCCTGGCGCCTGGTTCGTCTGGTTGTCGCCCTGGTTGCTTGGCAAGTCAGAATCCGATAGACATTTGATA
CCTCTCGGCGACCCTACCCAAGCACGGGTCATCGTGGGCCACAACGTTGGCTACGACCGAGCGAGAGTCCTTGAA
GAGTACAACGTGAAGCAGTCTCGAAATGCTTTCCTCGATACCATGTCTTTCCATGTCGCCGTCAACGGCATGTGC
TCGCAACAACGACCGACTTGGTTGAAGCACAAAAAAAACCGTGAATTGAGAGAGAGAGTGGCCGCTGAGACGCCA
GATCACGAACTTGCCGAGCTGCTCAGTGGCGATGGCATGAACGAAGAGGAGGAGCTGTGGGTGGAGAGAAGCTCA
ATCAACTCGCTGCGGGATGTCGCCAAGTTTCATCTCGACGTGACCATGGACAAGACGGTGCGAGACGACTTTGGG
ACCCTCGACCGTGATGGCGTCTTGGCCAAGCTCGACGAGCTGTTAGAGTACTGTGCAACGGATGTCTCCATCACG
CACAGCATCTACAAGATCGTCTTCCCCAACTTTCTCACCGTTTGTCCGCACCCGGTCAGTTTTGCTGCGCTGAGG
CATCTCACTTCTGTCATTCTTCCGGTCAACCGATCCTGGGATGACTACATCGCCAATGCAGAGGAAAAGTATCGT
CAGCTCTCTTCAGCCGTTCATGAACGGCTGATTGGCCTCACCGAGAAAGCACTTGCGTTGAAGGATGACGCGACT
CAGTGGGAGAGCGATCCTTGGCTGAATCAGCTCGATTGGTCCGGCCAGGAAATCCGCATGATCAAGGGCAAGAAA
AAAGGCGACCCTCCACGGCCAGCAAGGCAGAAGAAGCCGGGCATGCCCCGGTGGTACAAGGATCTGTTTGCCAAG
AGCGACTCGCCGCTGAATATTACTGTCAGAACCCGCATAGCGCCGCTGCTTCTGAAAATGTCGTGGGACGGCAAT
CCTCTTTTCTGGTCAACCAAGTACGGCTGGACGTTCCGAGTATCCAAAGATCAGACGGCAAAATATACGGCCAAG
CAGATGATCGAGTGTGAGTTCGACAAGGAAGACGCCCTTCTGCGGGACGACCTCGATCACGCCTACATTAAGCTC
CCACACAAGGACGGTCCTACTGCCCGCTGTGCGAATGTGCTCGCCAAGGGTTATCTGCCGTACTTTGAGAATGGG
ACCCTTTCCTCGGCGTATACCTACGCCAAAGAAGCGTTGGAGATGAACGCGTCTTGCTCTTACTGGATCAGCGCG
CGCGACCGTATCAGGGGCCAACTGGTTGTGTACGAAAACGAGCTGTCGCTGTCGCAAATCAAGGGCAAAGGCAAG
AGGGGCCGGAAGAAGCTGATGACCAACGAAAACGGCTTCATCCTGCCACAAATCATTCCCATGGGAACCATCACT
AGAAGGGCTGTGGAGAACACCTGGCTCACGGCGAGCAACGCCAAGAAGAATCGCGTGGGTTCGGAGCTAAAGGCC
ATGATCAAGGCCCCGGCAGGCTACTGCTTCGTCGGCGCCGACGTCGACTCTCAGGAACTGTGGATTGCCAGTCTT
GTGGGGGACGCAACGTTCAAGATCCACGGTGGCAATGCCGTCGGCTTCATGACGCTCGAAGGCACCAAGGCTGCC
GGCACGGACCTCCACTCGCGGACGGCGGGTATCTTGGGCATTTCGAGGAACGACGCCAAAGTCTTCAACTACGGG
CGCATCTACGGTGCGGGGCTCAAGTTCGCGGCGACGTTGCTACGGCAGTTCAATCCGTCCCTGACGGAAAAGGAG
ACGACGGACACGGCCTCGAAGCTGTACGCAAACACAAAAGGCACCAAGACCAACAGGAAATCGCTCCACCAGCGA
CCGTTTTGGCGAGGCGGGACCGAGTCTCTGGTCTTCAACAAGCTCGAGGAGTTCGCTGAGCAGGAGAGGCCGCGG
ACGCCGGTGCTGGGGGCCGGCATCACCGAGGCACTGATGGCCCGCTATATCAGCAAAGGTGGATATCTGACGTCT
CGCATCAACTGGGCGATCCAGTCGTCGGGCGTCGATTATCTTCACTTGTTGATCGTGTCAATGAACTACCTCGTC
ACGCGGTACGGCATCGACGCCCGACTGGCGATCACGGTGCACGACGAGATTCGTTACCTAGTGAAGACGGAAGAC
AGGTACAGAGCCGCACTGGCCCTACAAGTGGCCAATGTCTGGACAAGAGCCATGTTTGCGCAGCAGGTGGGTATA
GACGATCTGCCGCAGTCCTGCGCCTACTTTTCCGCCGTGGACATCGACCACGTGCTACGCAAGGAAGTGGATATG
GAGTGCGTGACGCCCAGTCATCCAACGCCGATTGCCCCGGGCGAGAGCTTGGACATCAAGACCCTGCTGGACAAG
GGACAAGAGGCGACACTGGGCCCGGTTGTCGTGGACGATGCTGCCAAGTTGCAACGCATAGAGTACGTCCCCCGT
GTGGCGGTGATGGAGACGATGCGAAAGACATCCGGGGATAGCATCGCCTTTATCAAGGCTCAAGTGGCCGACGAG
CTTGAGCTGCGAGACCTCGTCAGGCGTGCGAAGCCGGCGTCGCCCAAGGACTATACCAGGTACAACAAGTCGCAG
TTCGCTCGCCAGCCTTACCCTCACTTGATACCAAAGGAGACGCTACCGGTGACGGAGGCGATGGAGTCGACGTAT
CGGAGCGGAAGCAACGGCCTGAATCGTTGGCCTTGGTCCAACAATGCTGCCAAGGGGCCGCGGACTGCGTCGAGA
ATTTGA
Gene >Ophio5|5911
ATGTACATCTTCCCTGGCCGATCTCAATATGTCGCCGCGACTGGCCTCGCTTTCGTCGGTCGCCTCCGGACTTCC
CGTCGCTTTGCGTTGAGGCCGCAGTTGCGATGGCTAGCCAAGGCCGCGACTCTGGAAAGCCGCGGCAGTCTTGCA
GGTGGGATTCCTCTGGAATTTGGTTGCTGTTGCAGAAAGACGCTAACAGCGGCGGAACCAGTTACTTCGCAGCCG
CGCTTCAACGAGATTGGTGTGCAGCAGTTGAGCGCCCATGTGTTCAACCAGATCTTCCCCAATGGCTGCCAGCCG
GCGCCAAAAGAGCTGGTAGATCTTTCGAGAGAGCACCTGCGCCGACATGACCTCCTTGGCAAGACCGCCGACAAC
TCGGAACCGATTGCATTTGACCTGCCTCCGCTTCAGGGCCGCACTCTGGACGAACACTTTTACAGGCTTGGCAAA
GACTGTGCAGAGCCGTATCTGACGCTGGCGAAGCAATTTGCGAATGCCAAACTTCCGGAGAAACCCACCAGTTGG
CTGCGACAAAGTGGCTGGACCAAATATTACCCGGACGGGCGGACAGAGGCCGTCGATACGCCCGACGACGTCATG
CTCTGTTTTGACACCGAGACACTATATAAGGAGAGCCCCTTCTCGGTCATGGCTTGTGCGGCAAGCCCTGGCGCC
TGGTTCGTCTGGTTGTCGCCCTGGTTGCTTGGCAAGTCAGAATCCGATAGACATTTGATACCTCTCGGCGACCCT
ACCCAAGCACGGGTCATCGTGGGCCACAACGTTGGCTACGACCGAGCGAGAGTCCTTGAAGAGTACAACGTGAAG
CAGTCTCGAAATGCTTTCCTCGATACCATGTCTTTCCATGTCGCCGTCAACGGCATGTGCTCGCAACAACGACCG
ACTTGGTTGAAGCACAAAAAAAACCGTGAATTGAGAGAGAGAGTGGCCGCTGAGACGCCAGATCACGAACTTGCC
GAGCTGCTCAGTGGCGATGGCATGAACGAAGAGGAGGAGCTGTGGGTGGAGAGAAGCTCAATCAACTCGCTGCGG
GATGTCGCCAAGTTTCATCTCGACGTGACCATGGACAAGACGGTGCGAGACGACTTTGGGACCCTCGACCGTGAT
GGCGTCTTGGCCAAGCTCGACGAGCTGTTAGAGTACTGTGCAACGGATGTCTCCATCACGCACAGCATCTACAAG
ATCGTCTTCCCCAACTTTCTCACCGTTTGTCCGCACCCGGTCAGTTTTGCTGCGCTGAGGCATCTCACTTCTGTC
ATTCTTCCGGTCAACCGATCCTGGGATGACTACATCGCCAATGCAGAGGAAAAGTATCGTCAGCTCTCTTCAGCC
GTTCATGAACGGCTGATTGGCCTCACCGAGAAAGCACTTGCGTTGAAGGATGACGCGACTCAGTGGGAGAGCGAT
CCTTGGCTGAATCAGCTCGATTGGTCCGGCCAGGAAATCCGCATGATCAAGGGCAAGAAAAAAGGCGACCCTCCA
CGGCCAGCAAGGCAGAAGAAGCCGGGCATGCCCCGGTGGTACAAGGATCTGTTTGCCAAGAGCGACTCGCCGCTG
AATATTACTGTCAGAACCCGCATAGCGCCGCTGCTTCTGAAAATGTCGTGGGACGGCAATCCTCTTTTCTGGTCA
ACCAAGTACGGCTGGACGTTCCGAGTATCCAAAGATCAGACGGCAAAATATACGGCCAAGCAGATGATCGAGTGT
GAGTTCGACAAGGAAGACGCCCTTCTGCGGGACGACCTCGATCACGCCTACATTAAGCTCCCACACAAGGACGGT
CCTACTGCCCGCTGTGCGAATGTGCTCGCCAAGGGTTATCTGCCGTACTTTGAGAATGGGACCCTTTCCTCGGCG
TATACCTACGCCAAAGAAGCGTTGGAGATGAACGCGTCTTGCTCTTACTGGATCAGCGCGCGCGACCGTATCAGG
GGCCAACTGGTTGTGTACGAAAACGAGCTGTCGCTGTCGCAAATCAAGGGCAAAGGCAAGAGGGGCCGGAAGAAG
CTGATGACCAACGAAAACGGCTTCATCCTGCCACAAATCATTCCCATGGGAACCATCACTAGAAGGGCTGTGGAG
AACACCTGGCTCACGGCGAGCAACGCCAAGAAGAATCGCGTGGGTTCGGAGCTAAAGGCCATGATCAAGGCCCCG
GCAGGCTACTGCTTCGTCGGCGCCGACGTCGACTCTCAGGAACTGTGGATTGCCAGTCTTGTGGGGGACGCAACG
TTCAAGATCCACGGTGGCAATGCCGTCGGCTTCATGACGCTCGAAGGCACCAAGGCTGCCGGCACGGACCTCCAC
TCGCGGACGGCGGGTATCTTGGGCATTTCGAGGAACGACGCCAAAGTCTTCAACTACGGGCGCATCTACGGTGCG
GGGCTCAAGTTCGCGGCGACGTTGCTACGGCAGTTCAATCCGTCCCTGACGGAAAAGGAGACGACGGACACGGCC
TCGAAGCTGTACGCAAACACAAAAGGCACCAAGACCAACAGGAAATCGCTCCACCAGCGACCGTTTTGGCGAGGC
GGGACCGAGTCTCTGGTCTTCAACAAGCTCGAGGAGTTCGCTGAGCAGGAGAGGCCGCGGACGCCGGTGCTGGGG
GCCGGCATCACCGAGGCACTGATGGCCCGCTATATCAGCAAAGGTGGATATCTGACGTCTCGCATCAACTGGGCG
ATCCAGTCGTCGGGCGTCGATTATCTTCACTTGTTGATCGTGTCAATGAACTACCTCGTCACGCGGTACGGCATC
GACGCCCGACTGGCGATCACGGTGCACGACGAGATTCGTTACCTAGTGAAGACGGAAGACAGGTACAGAGCCGCA
CTGGCCCTACAAGTGGCCAATGTCTGGACAAGAGCCATGTTTGCGCAGCAGGTGGGTATAGACGATCTGCCGCAG
TCCTGCGCCTACTTTTCCGCCGTGGACATCGACCACGTGCTACGCAAGGAAGTGGATATGGAGTGCGTGACGCCC
AGTCATCCAACGCCGATTGCCCCGGGCGAGAGCTTGGACATCAAGACCCTGCTGGACAAGGGACAAGAGGCGACA
CTGGGCCCGGTTGTCGTGGACGATGCTGCCAAGTTGCAACGCATAGAGTACGTCCCCCGTGTGGCGGTGATGGAG
ACGATGCGAAAGACATCCGGGGATAGCATCGCCTTTATCAAGGCTCAAGTGGCCGACGAGCTTGAGCTGCGAGAC
CTCGTCAGGCGTGCGAAGCCGGCGTCGCCCAAGGACTATACCAGGTACAACAAGTCGCAGTTCGCTCGCCAGCCT
TACCCTCACTTGATACCAAAGGAGACGCTACCGGTGACGGAGGCGATGGAGTCGACGTATCGGAGCGGAAGCAAC
GGCCTGAATCGTTGGCCTTGGTCCAACAATGCTGCCAAGGGGCCGCGGACTGCGTCGAGAATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail