Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5910
Gene name
Locationscaffold_5:31469..32710
Strand-
Gene length (bp)1241
Transcript length (bp)1044
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 1.7E-10 266 313
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 4.5E-08 267 308
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 4.4E-07 268 314
PF13639 zf-RING_2 Ring finger domain 8.9E-07 267 309
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 7.0E-07 268 308
PF13445 zf-RING_UBOX RING-type zinc-finger 3.1E-06 268 306
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 6.6E-05 267 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5M807|RNF5_RAT E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegicus GN=Rnf5 PE=2 SV=1 245 312 2.0E-08
sp|O35445|RNF5_MOUSE E3 ubiquitin-protein ligase RNF5 OS=Mus musculus GN=Rnf5 PE=1 SV=1 245 312 2.0E-08
sp|Q99942|RNF5_HUMAN E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens GN=RNF5 PE=1 SV=1 245 312 3.0E-08
sp|P87176|SLX8_SCHPO E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slx8 PE=1 SV=1 247 312 4.0E-08
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 267 312 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5M807|RNF5_RAT E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegicus GN=Rnf5 PE=2 SV=1 245 312 2.0E-08
sp|O35445|RNF5_MOUSE E3 ubiquitin-protein ligase RNF5 OS=Mus musculus GN=Rnf5 PE=1 SV=1 245 312 2.0E-08
sp|Q99942|RNF5_HUMAN E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens GN=RNF5 PE=1 SV=1 245 312 3.0E-08
sp|P87176|SLX8_SCHPO E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slx8 PE=1 SV=1 247 312 4.0E-08
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 267 312 6.0E-08
sp|Q91YT2|RN185_MOUSE E3 ubiquitin-protein ligase RNF185 OS=Mus musculus GN=Rnf185 PE=2 SV=1 264 312 1.0E-07
sp|Q96GF1|RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens GN=RNF185 PE=1 SV=1 264 312 1.0E-07
sp|Q568Y3|RN185_RAT E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus GN=Rnf185 PE=2 SV=1 264 312 1.0E-07
sp|Q5RFK9|RN185_PONAB E3 ubiquitin-protein ligase RNF185 OS=Pongo abelii GN=RNF185 PE=2 SV=1 264 312 2.0E-07
sp|Q5ZIR9|RN185_CHICK E3 ubiquitin-protein ligase RNF185 OS=Gallus gallus GN=RNF185 PE=2 SV=1 264 312 3.0E-07
sp|Q6PC78|RN185_DANRE E3 ubiquitin-protein ligase RNF185 OS=Danio rerio GN=rnf185 PE=2 SV=1 264 312 4.0E-07
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 267 312 4.0E-07
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 267 312 4.0E-07
sp|Q8GUK7|RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana GN=RMA3 PE=1 SV=1 225 325 9.0E-07
sp|O64425|RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana GN=RMA1 PE=1 SV=1 250 312 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005680 anaphase-promoting complex Yes
GO:0008270 zinc ion binding Yes
GO:0061630 ubiquitin protein ligase activity Yes
GO:0097602 cullin family protein binding Yes
GO:0046872 metal ion binding Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0030163 protein catabolic process No
GO:1990234 transferase complex No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:1902494 catalytic complex No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0004842 ubiquitin-protein transferase activity No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0005515 protein binding No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0032991 protein-containing complex No
GO:0000151 ubiquitin ligase complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0044248 cellular catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0046914 transition metal ion binding No
GO:1901565 organonitrogen compound catabolic process No
GO:0016740 transferase activity No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:0009056 catabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0010498 proteasomal protein catabolic process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0044265 cellular macromolecule catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5910
MATAATLAEQLFDSSAELLLGDQIPESAEWQDAWPPGLPPLSSLSQEAVRASSPQLHSASSAADHPSSASKFSES
AQAHNLSSSWRLDHELDLAREWNEDSLDTVAFATTSRSTQAFPLPLVIRLFSIHQPPTLGRRSRLSLPHCPAQNS
HQIYQLGEQILPPDLAGNSLADMPPQRTRSSVDGSASNASAPAPKRRRTTLTRGFHQTAEPLALPKTSDDDPFVD
KVKSHDADVNDQTTIDLTEAETASEDVSTREPDRRVKISAFQCAICMDNVTTLTVTHCGHLYCQECLHSSLHVDS
TKGKCPMCRAKIDMKPRSTYSSKTKGFWPLELKFMTVDRKGKRKANS
Coding >Ophio5|5910
ATGGCGACGGCCGCCACGCTCGCCGAGCAACTCTTCGACTCGTCCGCTGAGCTTCTCCTGGGCGACCAGATACCG
GAATCCGCGGAGTGGCAAGACGCCTGGCCTCCTGGTCTTCCTCCATTGTCTTCGCTGTCTCAAGAGGCTGTCCGC
GCCTCGTCGCCTCAACTGCATTCGGCCTCGTCCGCGGCCGACCATCCATCCTCCGCCTCCAAGTTTTCAGAGTCC
GCTCAAGCTCACAATCTCTCATCTTCCTGGCGACTTGATCACGAGCTCGACTTGGCTCGCGAGTGGAACGAAGAT
AGCCTCGACACTGTCGCCTTCGCCACGACCTCGCGTTCCACACAAGCTTTTCCTCTCCCTCTAGTTATCCGTCTT
TTCTCGATACACCAGCCGCCAACGCTGGGCCGCCGCAGCAGGCTTTCGCTCCCGCATTGCCCAGCCCAGAACTCA
CATCAAATTTACCAACTAGGCGAACAAATCCTGCCACCCGATCTTGCTGGGAACTCTTTAGCCGACATGCCTCCC
CAACGAACACGGAGCTCCGTCGACGGCAGTGCAAGCAACGCCTCCGCTCCCGCTCCCAAGAGACGGCGAACGACC
CTGACGCGAGGCTTTCATCAAACCGCTGAACCTTTGGCTCTGCCCAAAACGTCCGACGATGACCCCTTTGTCGAC
AAGGTCAAGAGTCACGACGCCGATGTGAACGATCAGACCACCATCGACTTGACCGAGGCCGAGACCGCCTCCGAG
GACGTCAGTACGCGAGAGCCAGACCGGCGCGTCAAGATCTCGGCCTTTCAGTGTGCGATATGCATGGATAACGTC
ACGACGCTGACGGTGACCCATTGCGGCCACCTATACTGCCAAGAATGCCTCCACTCATCGCTACACGTGGACTCG
ACCAAGGGGAAATGCCCCATGTGCCGAGCCAAGATTGACATGAAGCCTCGCTCGACGTACTCTTCCAAGACCAAA
GGTTTCTGGCCTCTGGAGCTCAAGTTCATGACGGTTGACAGGAAGGGGAAGCGCAAGGCGAACTCA
Transcript >Ophio5|5910
ATGGCGACGGCCGCCACGCTCGCCGAGCAACTCTTCGACTCGTCCGCTGAGCTTCTCCTGGGCGACCAGATACCG
GAATCCGCGGAGTGGCAAGACGCCTGGCCTCCTGGTCTTCCTCCATTGTCTTCGCTGTCTCAAGAGGCTGTCCGC
GCCTCGTCGCCTCAACTGCATTCGGCCTCGTCCGCGGCCGACCATCCATCCTCCGCCTCCAAGTTTTCAGAGTCC
GCTCAAGCTCACAATCTCTCATCTTCCTGGCGACTTGATCACGAGCTCGACTTGGCTCGCGAGTGGAACGAAGAT
AGCCTCGACACTGTCGCCTTCGCCACGACCTCGCGTTCCACACAAGCTTTTCCTCTCCCTCTAGTTATCCGTCTT
TTCTCGATACACCAGCCGCCAACGCTGGGCCGCCGCAGCAGGCTTTCGCTCCCGCATTGCCCAGCCCAGAACTCA
CATCAAATTTACCAACTAGGCGAACAAATCCTGCCACCCGATCTTGCTGGGAACTCTTTAGCCGACATGCCTCCC
CAACGAACACGGAGCTCCGTCGACGGCAGTGCAAGCAACGCCTCCGCTCCCGCTCCCAAGAGACGGCGAACGACC
CTGACGCGAGGCTTTCATCAAACCGCTGAACCTTTGGCTCTGCCCAAAACGTCCGACGATGACCCCTTTGTCGAC
AAGGTCAAGAGTCACGACGCCGATGTGAACGATCAGACCACCATCGACTTGACCGAGGCCGAGACCGCCTCCGAG
GACGTCAGTACGCGAGAGCCAGACCGGCGCGTCAAGATCTCGGCCTTTCAGTGTGCGATATGCATGGATAACGTC
ACGACGCTGACGGTGACCCATTGCGGCCACCTATACTGCCAAGAATGCCTCCACTCATCGCTACACGTGGACTCG
ACCAAGGGGAAATGCCCCATGTGCCGAGCCAAGATTGACATGAAGCCTCGCTCGACGTACTCTTCCAAGACCAAA
GGTTTCTGGCCTCTGGAGCTCAAGTTCATGACGGTTGACAGGAAGGGGAAGCGCAAGGCGAACTCATAA
Gene >Ophio5|5910
ATGGCGACGGCCGCCACGCTCGCCGAGCAACTCTTCGACTCGTCCGCTGAGCTTCTCCTGGGCGACCAGATACCG
GAATCCGCGGAGTGGCAAGACGCCTGGCCTCCTGGTCTTCCTCCATTGTCTTCGCTGTCTCAAGAGGCTGTCCGC
GCCTCGTCGCCTCAACTGCATTCGGCCTCGTCCGCGGCCGACCATCCATCCTCCGCCTCCAAGTTTTCAGAGTCC
GCTCAAGCTCACAATCTCTCATCTTCCTGGCGACTTGATCACGAGCTCGACTTGGCTCGCGAGTGGAACGAAGAT
AGCCTCGACACTGTCGCCTTCGCCACGACCTCGCGTTCCACACAAGGCACGTCATCTCTAGACGACGAAGCCTAT
CTCAGCTTCCTCACCGAGAATAGCTTTTCCTCTCCCTCTAGTTATCCGTCTTTTCTCGATACACCAGCCGCCAAC
GCTGGGCCGCCGCAGCAGGCTTTCGCTCCCGCATTGCCCAGCCCAGTAGATCACCAAACTGCCCTCTACCTCGGC
GACGACTTTTCGTCTTCTCCGCAGCTAGCAGACGAACCCAACATATCACATTACAGGAACTCACATCAAATTTAC
CAACTAGGCGAACAAATCCTGCCACCCGATCTTGCTGGGAACTCTTTAGCCGACATGCCTCCCCAACGAACACGG
AGCTCCGTCGACGGCAGTGCAAGCAACGCCTCCGCTCCCGCTCCCAAGAGACGGCGAACGACCCTGACGCGAGGC
TTTCATCAAACCGCTGAACCTTTGGCTCTGCCCAAAACGTCCGACGATGACCCCTTTGTCGACAAGGTCAAGAGT
CACGACGCCGATGTGAACGATCAGACCACCATCGACTTGACCGAGGCCGAGACCGCCTCCGAGGACGTCAGTACG
CGAGAGCCAGACCGGCGCGTCAAGATCTCGGCCTTTCAGTGTGCGATATGCATGGATAACGTCACGACGCTGACG
GTGACCCATTGCGGTATGTATCCATGAGCACCATGTTCAGATCAAAGGACGTCGCTAACCAACTTTGTAAAGGCC
ACCTATACTGCCAAGAATGCCTCCACTCATCGCTACACGTGGACTCGACCAAGGGGAAATGCCCCATGTGCCGAG
CCAAGATTGACATGAAGCCTCGCTCGACGTACTCTTCCAAGACCAAAGGTTTCTGGCCTCTGGAGCTCAAGTTCA
TGACGGTTGACAGGAAGGGGAAGCGCAAGGCGAACTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail