Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|591
Gene name
Locationscaffold_1155:296..2690
Strand+
Gene length (bp)2394
Transcript length (bp)2136
Coding sequence length (bp)2133
Protein length (aa) 711

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05693 Glycogen_syn Glycogen synthase 0.0E+00 20 663

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93869|GYS_NEUCR Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gsy-1 PE=2 SV=2 1 711 0.0E+00
sp|P23337|GYS1_YEAST Glycogen [starch] synthase isoform 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSY1 PE=1 SV=3 10 670 0.0E+00
sp|P27472|GYS2_YEAST Glycogen [starch] synthase isoform 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSY2 PE=1 SV=3 10 660 0.0E+00
sp|P13834|GYS1_RABIT Glycogen [starch] synthase, muscle OS=Oryctolagus cuniculus GN=GYS1 PE=1 SV=4 12 669 0.0E+00
sp|A2RRU1|GYS1_RAT Glycogen [starch] synthase, muscle OS=Rattus norvegicus GN=Gys1 PE=1 SV=1 12 669 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93869|GYS_NEUCR Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gsy-1 PE=2 SV=2 1 711 0.0E+00
sp|P23337|GYS1_YEAST Glycogen [starch] synthase isoform 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSY1 PE=1 SV=3 10 670 0.0E+00
sp|P27472|GYS2_YEAST Glycogen [starch] synthase isoform 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSY2 PE=1 SV=3 10 660 0.0E+00
sp|P13834|GYS1_RABIT Glycogen [starch] synthase, muscle OS=Oryctolagus cuniculus GN=GYS1 PE=1 SV=4 12 669 0.0E+00
sp|A2RRU1|GYS1_RAT Glycogen [starch] synthase, muscle OS=Rattus norvegicus GN=Gys1 PE=1 SV=1 12 669 0.0E+00
sp|Q9Z1E4|GYS1_MOUSE Glycogen [starch] synthase, muscle OS=Mus musculus GN=Gys1 PE=1 SV=2 12 669 0.0E+00
sp|A7MB78|GYS1_BOVIN Glycogen [starch] synthase, muscle OS=Bos taurus GN=GYS1 PE=2 SV=1 12 643 0.0E+00
sp|P13807|GYS1_HUMAN Glycogen [starch] synthase, muscle OS=Homo sapiens GN=GYS1 PE=1 SV=2 12 684 0.0E+00
sp|Q8MJ26|GYS1_MACMU Glycogen [starch] synthase, muscle OS=Macaca mulatta GN=GYS1 PE=2 SV=1 12 643 0.0E+00
sp|Q5R9H0|GYS1_PONAB Glycogen [starch] synthase, muscle OS=Pongo abelii GN=GYS1 PE=2 SV=1 12 684 0.0E+00
sp|Q9U2D9|GYS_CAEEL Glycogen [starch] synthase OS=Caenorhabditis elegans GN=gsy-1 PE=1 SV=1 17 609 0.0E+00
sp|Q8VCB3|GYS2_MOUSE Glycogen [starch] synthase, liver OS=Mus musculus GN=Gys2 PE=1 SV=2 13 613 0.0E+00
sp|P17625|GYS2_RAT Glycogen [starch] synthase, liver OS=Rattus norvegicus GN=Gys2 PE=1 SV=2 13 613 0.0E+00
sp|P54840|GYS2_HUMAN Glycogen [starch] synthase, liver OS=Homo sapiens GN=GYS2 PE=1 SV=2 21 613 0.0E+00
sp|Q9VFC8|GYS_DROME Glycogen [starch] synthase OS=Drosophila melanogaster GN=GlyS PE=1 SV=2 14 643 0.0E+00
sp|Q55GH4|GYS_DICDI Glycogen [starch] synthase OS=Dictyostelium discoideum GN=glcS PE=3 SV=1 17 609 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0004373 glycogen (starch) synthase activity Yes
GO:0005978 glycogen biosynthetic process Yes
GO:0034645 cellular macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0016758 hexosyltransferase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0005975 carbohydrate metabolic process No
GO:0006112 energy reserve metabolic process No
GO:0044238 primary metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:0044262 cellular carbohydrate metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0006091 generation of precursor metabolites and energy No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0005976 polysaccharide metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0003824 catalytic activity No
GO:0044042 glucan metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0009250 glucan biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0016051 carbohydrate biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0006073 cellular glucan metabolic process No
GO:0005977 glycogen metabolic process No
GO:0000271 polysaccharide biosynthetic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|591
MATEAEPPRARDVKNHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHQSAAVEVEEMEPTNLE
IAATMQSMKERGIGMLYGRWLIEGAPRVLLIDTKTAYGYLNEWKADLWNIASIPSPPNDDETNETIVFGYLVAWF
LGEFVCREKTKAVIAHFHEWLSGVALPLTKKRRIDVTTIFTTHATLLGRYLCAGSVDFYNNLQFFDVDAEAGKRG
IYHRYCIERAAAHSCDVFTTVSHITAFESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQAKEKIHDFVRGHF
YGHYDFDTENTLYLFTAGRYEFRNKGVDMFIESLARLNHRLKSTGSKMTVVAFIIMPAQTTSLTVEALKGQAVIK
SLRDTTAVIEQSIGRRLFERSLKWHDGDPMPDEKEMLSGQDRVLLRRRLFAMKRSGLPPIVTHNMINDHDDPVLN
QIRRVQLFNDPTDRVKVVFHPEFLNSANPVLPLDYDDFVRGCHMGVFPSYYEPWGYTPAECTVMGVPSITTNLSG
FGCYMEELIENSSDYGIYIVDRRTKGVDDSVNQLTTHMLDFCGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKA
RQLALRRVYAASFTGTGDEDEDSDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREGLSTEDYVAWKL
PDEEDGDEYPFPLTLRTTKGTAEAAATGAPAKLNGS
Coding >Ophio5|591
ATGGCTACCGAAGCCGAGCCGCCCCGAGCGCGCGACGTCAAGAACCATCTTCTGTTCGAGATTGCTACCGAGGTG
GCTCATCGCGTCGGCGGCATCTACTCGGTCATCAAGTCCAAGGCTCCCGTGACGACGGCCGAATATGGCGACCGC
TATACACTTATCGGCCCCCTCAACCATCAATCGGCTGCGGTCGAGGTGGAAGAGATGGAGCCCACCAATTTGGAG
ATTGCTGCCACGATGCAATCCATGAAGGAGCGAGGCATTGGTATGCTGTACGGTCGATGGCTGATTGAGGGCGCA
CCTCGCGTCCTTCTCATTGACACCAAGACGGCGTACGGATATCTCAACGAGTGGAAGGCGGACCTGTGGAACATT
GCCAGCATCCCGTCGCCGCCCAACGACGACGAGACCAACGAGACGATTGTTTTTGGCTACCTGGTAGCTTGGTTC
CTGGGCGAGTTTGTGTGCCGCGAGAAAACCAAGGCCGTCATCGCCCATTTTCACGAGTGGCTCTCGGGCGTGGCG
CTGCCTCTGACCAAGAAGCGGCGGATCGACGTGACGACCATCTTCACGACGCACGCCACCCTGCTCGGCCGCTAT
CTCTGCGCCGGTTCCGTCGACTTTTACAACAACCTGCAATTCTTTGACGTGGACGCCGAGGCCGGCAAGCGAGGC
ATCTATCACAGGTACTGCATCGAGCGGGCGGCGGCGCACTCGTGCGACGTTTTCACGACAGTTTCGCACATCACG
GCCTTTGAGTCGGAGCACCTGCTGAAGCGCAAGCCCGACGGCGTGCTGCCCAATGGGCTCAATGTGACCAAGTTC
TCGGCCGTGCACGAGTTCCAGAACCTGCACCAGCAGGCCAAGGAGAAGATCCACGACTTTGTGCGCGGCCATTTT
TACGGCCACTACGACTTTGACACGGAGAATACGCTGTACCTGTTCACGGCGGGCCGGTACGAATTCCGCAACAAG
GGCGTCGACATGTTCATCGAATCGCTGGCCCGGCTCAACCACCGGCTCAAGTCGACGGGCAGCAAGATGACGGTG
GTGGCCTTCATCATCATGCCGGCGCAGACGACGTCGTTGACGGTGGAGGCGCTCAAGGGCCAGGCCGTCATCAAG
TCGCTGCGAGACACGACGGCAGTCATCGAGCAGAGCATCGGGCGGCGGTTGTTTGAGCGCTCCCTCAAGTGGCAC
GACGGTGACCCGATGCCGGACGAGAAGGAGATGCTCTCGGGCCAGGACCGGGTTCTGCTGCGGCGACGGCTGTTC
GCCATGAAGCGGAGCGGGCTGCCGCCGATTGTGACGCACAACATGATCAACGACCACGACGACCCGGTGCTGAAC
CAGATCCGGCGGGTGCAGCTGTTCAATGACCCGACGGACCGGGTCAAGGTGGTGTTCCACCCCGAGTTCCTCAAC
TCGGCGAACCCGGTGCTACCGCTGGACTACGACGACTTCGTGCGCGGCTGCCACATGGGCGTCTTCCCGTCGTAC
TACGAGCCTTGGGGGTATACGCCGGCCGAGTGCACCGTCATGGGCGTGCCCAGCATCACGACGAACCTGTCGGGG
TTCGGGTGCTACATGGAGGAGCTGATTGAGAACTCGAGCGACTACGGCATCTACATTGTGGATCGGCGGACCAAG
GGCGTCGACGACTCGGTCAACCAGCTGACGACGCACATGTTGGACTTTTGCGGCAAGAGCCGGCGACAGCGCATC
AATCAGCGTAACCGGACGGAGCGGCTGAGCGACCTGCTGGACTGGAAGCGCATGGGCATGGAGTACGTCAAGGCG
CGGCAGTTGGCGCTGCGGCGCGTGTACGCGGCATCCTTTACCGGCACGGGCGACGAGGATGAGGATTCCGACTTC
ATCCCGGGCGTGGAGCAGAAGATATCGCGGCCGTTTTCCGTGCCGGGATCGCCGAGGGACCGCACGGGCATGATG
ACGCCGGGCGACTTTGCGAGCCTGCAGGAGGGGCGCGAGGGTCTGAGCACCGAGGATTATGTGGCGTGGAAACTA
CCGGACGAGGAAGACGGCGACGAGTACCCGTTTCCGCTGACGCTGCGGACGACCAAGGGGACGGCAGAGGCGGCG
GCGACGGGGGCGCCGGCCAAGCTCAACGGCAGC
Transcript >Ophio5|591
ATGGCTACCGAAGCCGAGCCGCCCCGAGCGCGCGACGTCAAGAACCATCTTCTGTTCGAGATTGCTACCGAGGTG
GCTCATCGCGTCGGCGGCATCTACTCGGTCATCAAGTCCAAGGCTCCCGTGACGACGGCCGAATATGGCGACCGC
TATACACTTATCGGCCCCCTCAACCATCAATCGGCTGCGGTCGAGGTGGAAGAGATGGAGCCCACCAATTTGGAG
ATTGCTGCCACGATGCAATCCATGAAGGAGCGAGGCATTGGTATGCTGTACGGTCGATGGCTGATTGAGGGCGCA
CCTCGCGTCCTTCTCATTGACACCAAGACGGCGTACGGATATCTCAACGAGTGGAAGGCGGACCTGTGGAACATT
GCCAGCATCCCGTCGCCGCCCAACGACGACGAGACCAACGAGACGATTGTTTTTGGCTACCTGGTAGCTTGGTTC
CTGGGCGAGTTTGTGTGCCGCGAGAAAACCAAGGCCGTCATCGCCCATTTTCACGAGTGGCTCTCGGGCGTGGCG
CTGCCTCTGACCAAGAAGCGGCGGATCGACGTGACGACCATCTTCACGACGCACGCCACCCTGCTCGGCCGCTAT
CTCTGCGCCGGTTCCGTCGACTTTTACAACAACCTGCAATTCTTTGACGTGGACGCCGAGGCCGGCAAGCGAGGC
ATCTATCACAGGTACTGCATCGAGCGGGCGGCGGCGCACTCGTGCGACGTTTTCACGACAGTTTCGCACATCACG
GCCTTTGAGTCGGAGCACCTGCTGAAGCGCAAGCCCGACGGCGTGCTGCCCAATGGGCTCAATGTGACCAAGTTC
TCGGCCGTGCACGAGTTCCAGAACCTGCACCAGCAGGCCAAGGAGAAGATCCACGACTTTGTGCGCGGCCATTTT
TACGGCCACTACGACTTTGACACGGAGAATACGCTGTACCTGTTCACGGCGGGCCGGTACGAATTCCGCAACAAG
GGCGTCGACATGTTCATCGAATCGCTGGCCCGGCTCAACCACCGGCTCAAGTCGACGGGCAGCAAGATGACGGTG
GTGGCCTTCATCATCATGCCGGCGCAGACGACGTCGTTGACGGTGGAGGCGCTCAAGGGCCAGGCCGTCATCAAG
TCGCTGCGAGACACGACGGCAGTCATCGAGCAGAGCATCGGGCGGCGGTTGTTTGAGCGCTCCCTCAAGTGGCAC
GACGGTGACCCGATGCCGGACGAGAAGGAGATGCTCTCGGGCCAGGACCGGGTTCTGCTGCGGCGACGGCTGTTC
GCCATGAAGCGGAGCGGGCTGCCGCCGATTGTGACGCACAACATGATCAACGACCACGACGACCCGGTGCTGAAC
CAGATCCGGCGGGTGCAGCTGTTCAATGACCCGACGGACCGGGTCAAGGTGGTGTTCCACCCCGAGTTCCTCAAC
TCGGCGAACCCGGTGCTACCGCTGGACTACGACGACTTCGTGCGCGGCTGCCACATGGGCGTCTTCCCGTCGTAC
TACGAGCCTTGGGGGTATACGCCGGCCGAGTGCACCGTCATGGGCGTGCCCAGCATCACGACGAACCTGTCGGGG
TTCGGGTGCTACATGGAGGAGCTGATTGAGAACTCGAGCGACTACGGCATCTACATTGTGGATCGGCGGACCAAG
GGCGTCGACGACTCGGTCAACCAGCTGACGACGCACATGTTGGACTTTTGCGGCAAGAGCCGGCGACAGCGCATC
AATCAGCGTAACCGGACGGAGCGGCTGAGCGACCTGCTGGACTGGAAGCGCATGGGCATGGAGTACGTCAAGGCG
CGGCAGTTGGCGCTGCGGCGCGTGTACGCGGCATCCTTTACCGGCACGGGCGACGAGGATGAGGATTCCGACTTC
ATCCCGGGCGTGGAGCAGAAGATATCGCGGCCGTTTTCCGTGCCGGGATCGCCGAGGGACCGCACGGGCATGATG
ACGCCGGGCGACTTTGCGAGCCTGCAGGAGGGGCGCGAGGGTCTGAGCACCGAGGATTATGTGGCGTGGAAACTA
CCGGACGAGGAAGACGGCGACGAGTACCCGTTTCCGCTGACGCTGCGGACGACCAAGGGGACGGCAGAGGCGGCG
GCGACGGGGGCGCCGGCCAAGCTCAACGGCAGCTAG
Gene >Ophio5|591
ATGGCTACCGAAGCCGAGCCGCCCCGAGCGCGCGACGTCAAGAACCATCTTCTGTTCGAGATTGCTACCGAGGTG
GCTCATCGCGGTATTGTCCTCACCAAGGTGCGCCTGCTCGAAACCCACTGACACGATTCGCAGTCGGCGGCATCT
ACTCGGTCATCAAGTCCAAGGCTCCCGTGACGACGGCCGAATATGGCGACCGCTATACACTTATCGGCCCCCTCA
ACCATCAATCGGTCTGCCGCGCTCTCCCCCTCTCCCTCTCTCCCCGTCTGGTCTTTGGACTAACGACACCAGGCT
GCGGTCGAGGTGGAAGAGATGGAGCCCACCAATTTGGAGATTGCTGCCACGATGCAATCCATGAAGGAGCGAGGC
ATTGGTATGCTGTACGGTCGATGGCTGATTGAGGGCGCACCTCGCGTCCTTCTCATTGACACCAAGACGGCGTAC
GGATATCTCAACGAGTGGAAGGCGGACCTGTGGAACATTGCCAGCATCCCGTCGCCGCCCAACGACGACGAGACC
AACGAGACGATTGTTTTTGGCTACCTGGTAGCTTGGTTCCTGGGCGAGGTGAGCATGAGGCTTTCTCCCACGACT
CCCTTTTTTTTTTTTGGGCTGTGTTATTGGGACTTATAAACTGACGGCAGGGCAGTTTGTGTGCCGCGAGAAAAC
CAAGGCCGTCATCGCCCATTTTCACGAGTGGCTCTCGGGCGTGGCGCTGCCTCTGACCAAGAAGCGGCGGATCGA
CGTGACGACCATCTTCACGACGCACGCCACCCTGCTCGGCCGCTATCTCTGCGCCGGTTCCGTCGACTTTTACAA
CAACCTGCAATTCTTTGACGTGGACGCCGAGGCCGGCAAGCGAGGCATCTATCACAGGTACTGCATCGAGCGGGC
GGCGGCGCACTCGTGCGACGTTTTCACGACAGTTTCGCACATCACGGCCTTTGAGTCGGAGCACCTGCTGAAGCG
CAAGCCCGACGGCGTGCTGCCCAATGGGCTCAATGTGACCAAGTTCTCGGCCGTGCACGAGTTCCAGAACCTGCA
CCAGCAGGCCAAGGAGAAGATCCACGACTTTGTGCGCGGCCATTTTTACGGCCACTACGACTTTGACACGGAGAA
TACGCTGTACCTGTTCACGGCGGGCCGGTACGAATTCCGCAACAAGGGCGTCGACATGTTCATCGAATCGCTGGC
CCGGCTCAACCACCGGCTCAAGTCGACGGGCAGCAAGATGACGGTGGTGGCCTTCATCATCATGCCGGCGCAGAC
GACGTCGTTGACGGTGGAGGCGCTCAAGGGCCAGGCCGTCATCAAGTCGCTGCGAGACACGACGGCAGTCATCGA
GCAGAGCATCGGGCGGCGGTTGTTTGAGCGCTCCCTCAAGTGGCACGACGGTGACCCGATGCCGGACGAGAAGGA
GATGCTCTCGGGCCAGGACCGGGTTCTGCTGCGGCGACGGCTGTTCGCCATGAAGCGGAGCGGGCTGCCGCCGAT
TGTGACGCACAACATGATCAACGACCACGACGACCCGGTGCTGAACCAGATCCGGCGGGTGCAGCTGTTCAATGA
CCCGACGGACCGGGTCAAGGTGGTGTTCCACCCCGAGTTCCTCAACTCGGCGAACCCGGTGCTACCGCTGGACTA
CGACGACTTCGTGCGCGGCTGCCACATGGGCGTCTTCCCGTCGTACTACGAGCCTTGGGGGTATACGCCGGCCGA
GTGCACCGTCATGGGCGTGCCCAGCATCACGACGAACCTGTCGGGGTTCGGGTGCTACATGGAGGAGCTGATTGA
GAACTCGAGCGACTACGGCATCTACATTGTGGATCGGCGGACCAAGGGCGTCGACGACTCGGTCAACCAGCTGAC
GACGCACATGTTGGACTTTTGCGGCAAGAGCCGGCGACAGCGCATCAATCAGCGTAACCGGACGGAGCGGCTGAG
CGACCTGCTGGACTGGAAGCGCATGGGCATGGAGTACGTCAAGGCGCGGCAGTTGGCGCTGCGGCGCGTGTACGC
GGCATCCTTTACCGGCACGGGCGACGAGGATGAGGATTCCGACTTCATCCCGGGCGTGGAGCAGAAGATATCGCG
GCCGTTTTCCGTGCCGGGATCGCCGAGGGACCGCACGGGCATGATGACGCCGGGCGACTTTGCGAGCCTGCAGGA
GGGGCGCGAGGGTCTGAGCACCGAGGATTATGTGGCGTGGAAACTACCGTGGGTTTTCTCCATTTTGTGTTGAGG
CGCCTATGACTGACTGACTGAGATGGGATGGACAGGGACGAGGAAGACGGCGACGAGTACCCGTTTCCGCTGACG
CTGCGGACGACCAAGGGGACGGCAGAGGCGGCGGCGACGGGGGCGCCGGCCAAGCTCAACGGCAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail