Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|59
Gene name
Locationscaffold_1:145530..146750
Strand-
Gene length (bp)1220
Transcript length (bp)1155
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14610 Psg1 Ykl077w/Psg1 (Pma1 Stabilization in Golgi) 3.8E-35 119 295

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 266 288 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 46.28 23.93 68.62
CcL In ants, during behavior modification 111.10 59.65 162.56
CcD In ants, recently dead 83.18 45.66 120.70

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.007782 yes
CcL CcD 0.205489 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|59
MKTSGASALFASLALAGLCVAMPSPTPTAVPLLVRRGEDELTVSEEDYTTVAPTAPWVTVDDEGQPAMTVTPSIN
TISGTTTVEHGAPHDLTASVYTWITWGAITTSTGTPPNPTAVDGKTGQGAFSRCFNRDDQELAPFCRPLANSTLL
TGTTYYVTWDPDFYKNAASDNTTTLEVAVRLDFLNQSSNEWAKLDTYDRVPAKWGFWPLRLRTEHLKGQRYNNAT
ITLVVSPRGGDERNKSVALPVTLTSLGVDDMPPPRVPKGSTLLIALPVSLASFFLVLIGLYLWHRQTRTINLGNI
MGRSRHGYNGRRHRRHRFLASARHRQQQQQQQQQQPHPQEEPRVPLNTVATEFRDLPSPTEDPDVVGGLQREKMK
LYGAKGPRR
Coding >Ophio5|59
ATGAAGACCAGCGGCGCGTCCGCCCTCTTCGCCAGCTTGGCCCTCGCCGGTCTCTGCGTCGCCATGCCCTCTCCC
ACGCCTACAGCAGTCCCCCTACTCGTCCGTCGGGGAGAGGACGAATTGACGGTCTCGGAAGAAGACTATACCACC
GTCGCCCCGACTGCCCCCTGGGTCACCGTCGACGATGAGGGTCAACCTGCCATGACGGTCACGCCGTCGATCAAT
ACCATCAGCGGCACAACGACGGTCGAGCACGGCGCTCCGCACGACCTGACGGCCTCCGTCTATACTTGGATCACT
TGGGGCGCCATCACCACCAGCACCGGCACGCCTCCTAACCCAACCGCCGTCGACGGCAAGACGGGTCAGGGCGCC
TTTTCGCGTTGCTTCAACCGTGACGACCAAGAGCTCGCTCCTTTCTGCCGGCCATTGGCCAACTCGACACTTCTC
ACAGGCACAACCTACTACGTCACTTGGGATCCCGACTTCTACAAAAACGCCGCGTCGGACAACACCACCACCCTC
GAGGTAGCCGTCCGACTCGACTTCCTCAACCAAAGCAGCAACGAATGGGCCAAGCTCGACACCTACGACCGCGTC
CCCGCCAAATGGGGCTTCTGGCCCTTGCGCCTCCGGACGGAGCACCTCAAGGGCCAGCGCTACAACAACGCCACC
ATCACCCTCGTCGTCTCCCCTCGAGGCGGCGACGAGCGCAACAAGTCGGTCGCCCTCCCCGTCACCCTGACCAGC
CTCGGCGTCGACGACATGCCTCCCCCGCGTGTCCCCAAGGGTTCCACCCTCCTCATCGCCCTGCCCGTCTCCCTC
GCCTCCTTTTTCCTCGTCCTCATCGGCTTGTACCTCTGGCATCGTCAGACGCGTACCATCAACCTCGGCAACATC
ATGGGCCGCTCTCGTCACGGTTATAACGGCCGTCGTCACCGCCGTCACCGTTTCCTCGCTTCCGCTCGCCACCGC
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCCATCCCCAGGAAGAGCCCCGCGTGCCGCTCAACACCGTCGCC
ACCGAATTCCGCGACTTGCCCTCCCCGACCGAGGACCCAGACGTCGTCGGTGGTCTGCAGCGCGAAAAGATGAAG
CTCTACGGCGCAAAGGGTCCGAGACGG
Transcript >Ophio5|59
ATGAAGACCAGCGGCGCGTCCGCCCTCTTCGCCAGCTTGGCCCTCGCCGGTCTCTGCGTCGCCATGCCCTCTCCC
ACGCCTACAGCAGTCCCCCTACTCGTCCGTCGGGGAGAGGACGAATTGACGGTCTCGGAAGAAGACTATACCACC
GTCGCCCCGACTGCCCCCTGGGTCACCGTCGACGATGAGGGTCAACCTGCCATGACGGTCACGCCGTCGATCAAT
ACCATCAGCGGCACAACGACGGTCGAGCACGGCGCTCCGCACGACCTGACGGCCTCCGTCTATACTTGGATCACT
TGGGGCGCCATCACCACCAGCACCGGCACGCCTCCTAACCCAACCGCCGTCGACGGCAAGACGGGTCAGGGCGCC
TTTTCGCGTTGCTTCAACCGTGACGACCAAGAGCTCGCTCCTTTCTGCCGGCCATTGGCCAACTCGACACTTCTC
ACAGGCACAACCTACTACGTCACTTGGGATCCCGACTTCTACAAAAACGCCGCGTCGGACAACACCACCACCCTC
GAGGTAGCCGTCCGACTCGACTTCCTCAACCAAAGCAGCAACGAATGGGCCAAGCTCGACACCTACGACCGCGTC
CCCGCCAAATGGGGCTTCTGGCCCTTGCGCCTCCGGACGGAGCACCTCAAGGGCCAGCGCTACAACAACGCCACC
ATCACCCTCGTCGTCTCCCCTCGAGGCGGCGACGAGCGCAACAAGTCGGTCGCCCTCCCCGTCACCCTGACCAGC
CTCGGCGTCGACGACATGCCTCCCCCGCGTGTCCCCAAGGGTTCCACCCTCCTCATCGCCCTGCCCGTCTCCCTC
GCCTCCTTTTTCCTCGTCCTCATCGGCTTGTACCTCTGGCATCGTCAGACGCGTACCATCAACCTCGGCAACATC
ATGGGCCGCTCTCGTCACGGTTATAACGGCCGTCGTCACCGCCGTCACCGTTTCCTCGCTTCCGCTCGCCACCGC
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCCATCCCCAGGAAGAGCCCCGCGTGCCGCTCAACACCGTCGCC
ACCGAATTCCGCGACTTGCCCTCCCCGACCGAGGACCCAGACGTCGTCGGTGGTCTGCAGCGCGAAAAGATGAAG
CTCTACGGCGCAAAGGGTCCGAGACGGTAA
Gene >Ophio5|59
ATGAAGACCAGCGGCGCGTCCGCCCTCTTCGCCAGCTTGGCCCTCGCCGGTCTCTGCGTCGCCATGCCCTCTCCC
ACGCCTACAGCAGTCCCCCTACTCGTCCGTCGGGGAGAGGACGAATTGACGGTCTCGGAAGAAGACTATACCACC
GTCGCCCCGACTGCCCCCTGGGTCACCGTCGACGATGAGGGTCAACCTGCCATGACGGTCACGCCGTCGATCAAT
ACCATCAGCGGCACAACGACGGTCGAGCACGGCGCTCCGCACGACCTGACGGCCTCCGTCTATACTTGGATCACT
TGGGGCGCCATCACCACCAGCACCGGCACGCCTCCTAACCCAACCGCCGTCGACGGCAAGACGGGTCAGGGCGCC
TTTTCGCGTTGCTTCAACCGTGACGACCAAGAGCTCGCTCCTTTCTGCCGGCCATTGGCCAACTCGACACTTCTC
ACAGGCACAACCTACTACGGTAATATATATATATAGGACCAACCTCCTTTTGATTCCCACCACTAACAAAACTCT
CCCCTCAAGTCACTTGGGATCCCGACTTCTACAAAAACGCCGCGTCGGACAACACCACCACCCTCGAGGTAGCCG
TCCGACTCGACTTCCTCAACCAAAGCAGCAACGAATGGGCCAAGCTCGACACCTACGACCGCGTCCCCGCCAAAT
GGGGCTTCTGGCCCTTGCGCCTCCGGACGGAGCACCTCAAGGGCCAGCGCTACAACAACGCCACCATCACCCTCG
TCGTCTCCCCTCGAGGCGGCGACGAGCGCAACAAGTCGGTCGCCCTCCCCGTCACCCTGACCAGCCTCGGCGTCG
ACGACATGCCTCCCCCGCGTGTCCCCAAGGGTTCCACCCTCCTCATCGCCCTGCCCGTCTCCCTCGCCTCCTTTT
TCCTCGTCCTCATCGGCTTGTACCTCTGGCATCGTCAGACGCGTACCATCAACCTCGGCAACATCATGGGCCGCT
CTCGTCACGGTTATAACGGCCGTCGTCACCGCCGTCACCGTTTCCTCGCTTCCGCTCGCCACCGCCAGCAGCAGC
AGCAGCAGCAGCAGCAGCAGCCCCATCCCCAGGAAGAGCCCCGCGTGCCGCTCAACACCGTCGCCACCGAATTCC
GCGACTTGCCCTCCCCGACCGAGGACCCAGACGTCGTCGGTGGTCTGCAGCGCGAAAAGATGAAGCTCTACGGCG
CAAAGGGTCCGAGACGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail