Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5898
Gene name
Locationscaffold_499:2953..3544
Strand+
Gene length (bp)591
Transcript length (bp)465
Coding sequence length (bp)462
Protein length (aa) 154

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13279 4HBT_2 Thioesterase-like superfamily 1.8E-09 24 132
PF03061 4HBT Thioesterase superfamily 3.1E-09 32 106
PF01643 Acyl-ACP_TE Acyl-ACP thioesterase 5.1E-05 11 46

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016790 thiolester hydrolase activity Yes
GO:0006633 fatty acid biosynthetic process Yes
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0016787 hydrolase activity No
GO:0032787 monocarboxylic acid metabolic process No
GO:0006631 fatty acid metabolic process No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.4207 0.396 0.0024 0.1086 0.0429 0.2349 0.3086 0.213 0.0644 0.571

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5842
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7375
Ophiocordyceps australis map64 (Brazil) OphauB2|2340
Ophiocordyceps camponoti-floridani Ophcf2|02525
Ophiocordyceps camponoti-rufipedis Ophun1|6121
Ophiocordyceps kimflemingae Ophio5|5898 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5898
MPASGERQARRRKDYPFMLDYRTRWNDNDMYDHVNNSVYNFLFDSAVNAYLADYCGINPPNSPQHPLVAHTETDY
FRPIAYPSVADVGLRVVRLGHSSVTYELGLFERGVEPVCAVCHFVHVFVDRADGRPSPQGLGPDLRAGLERIVVS
ASKI
Coding >Ophio5|5898
ATGCCGGCGTCGGGTGAGCGCCAGGCTCGTCGCCGCAAGGATTACCCCTTCATGCTGGATTACCGCACCCGCTGG
AATGACAACGACATGTACGACCACGTCAACAACTCCGTCTACAACTTCCTCTTCGACTCTGCCGTCAACGCCTAC
CTCGCCGACTACTGCGGCATCAACCCTCCCAACTCACCTCAGCACCCTCTCGTCGCTCACACGGAAACCGACTAC
TTCCGTCCCATCGCCTACCCGTCCGTGGCCGACGTCGGCCTTCGCGTCGTCCGCCTCGGCCACTCCAGCGTCACC
TACGAGCTTGGTTTGTTTGAGCGCGGCGTCGAGCCCGTCTGCGCCGTCTGTCACTTCGTCCACGTCTTCGTCGAT
CGTGCTGATGGCCGACCCAGCCCACAAGGTCTAGGGCCGGATCTGCGCGCCGGGCTGGAGCGCATTGTTGTTTCC
GCCAGCAAGATC
Transcript >Ophio5|5898
ATGCCGGCGTCGGGTGAGCGCCAGGCTCGTCGCCGCAAGGATTACCCCTTCATGCTGGATTACCGCACCCGCTGG
AATGACAACGACATGTACGACCACGTCAACAACTCCGTCTACAACTTCCTCTTCGACTCTGCCGTCAACGCCTAC
CTCGCCGACTACTGCGGCATCAACCCTCCCAACTCACCTCAGCACCCTCTCGTCGCTCACACGGAAACCGACTAC
TTCCGTCCCATCGCCTACCCGTCCGTGGCCGACGTCGGCCTTCGCGTCGTCCGCCTCGGCCACTCCAGCGTCACC
TACGAGCTTGGTTTGTTTGAGCGCGGCGTCGAGCCCGTCTGCGCCGTCTGTCACTTCGTCCACGTCTTCGTCGAT
CGTGCTGATGGCCGACCCAGCCCACAAGGTCTAGGGCCGGATCTGCGCGCCGGGCTGGAGCGCATTGTTGTTTCC
GCCAGCAAGATCTGA
Gene >Ophio5|5898
ATGCCGGCGTCGGGTGAGCGCCAGGCTCGTCGCCGCAAGGATTACCCCTTCATGCTGGATTACCGCACCCGCTGG
TCAATAACTCCTCCCCGGCACAAGCAAAGCCAATAGTCAACTGACGAGCCGAAAGGAATGACAACGACATGTACG
ACCACGTCAACAACTCCGTCTACAACTTCCTGTCGGCCTCCCTCTCCCTACAGTCTAGCTTTTTCCTCCTCCCCC
AATGCTAAGAACCTGCCCCCTCTCAGCTTCGACTCTGCCGTCAACGCCTACCTCGCCGACTACTGCGGCATCAAC
CCTCCCAACTCACCTCAGCACCCTCTCGTCGCTCACACGGAAACCGACTACTTCCGTCCCATCGCCTACCCGTCC
GTGGCCGACGTCGGCCTTCGCGTCGTCCGCCTCGGCCACTCCAGCGTCACCTACGAGCTTGGTTTGTTTGAGCGC
GGCGTCGAGCCCGTCTGCGCCGTCTGTCACTTCGTCCACGTCTTCGTCGATCGTGCTGATGGCCGACCCAGCCCA
CAAGGTCTAGGGCCGGATCTGCGCGCCGGGCTGGAGCGCATTGTTGTTTCCGCCAGCAAGATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail