Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5887
Gene name
Locationscaffold_497:4497..6584
Strand-
Gene length (bp)2087
Transcript length (bp)1728
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.1E-26 78 488
PF00083 Sugar_tr Sugar (and other) transporter 2.0E-05 108 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 12 566 4.0E-40
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 15 565 2.0E-35
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 47 562 4.0E-17
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 11 251 2.0E-14
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 12 251 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 12 566 4.0E-40
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 15 565 2.0E-35
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 47 562 4.0E-17
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 11 251 2.0E-14
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 12 251 4.0E-14
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 22 270 1.0E-12
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 57 251 3.0E-12
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 31 561 3.0E-12
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 56 251 3.0E-12
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 6 297 8.0E-12
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 25 272 2.0E-11
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 47 560 2.0E-11
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 57 287 4.0E-09
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 28 251 5.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 57 276 3.0E-08
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 54 560 8.0E-08
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 19 251 1.0E-07
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 40 561 3.0E-07
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 51 334 5.0E-07
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 56 271 8.0E-07
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 34 560 2.0E-06
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 57 251 5.0E-06
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 11 225 7.0E-06
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 56 292 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 109 131 22
3 138 157 19
4 170 192 22
5 199 216 17
6 226 248 22
7 360 382 22
8 392 414 22
9 434 456 22
10 471 493 22
11 500 522 22
12 534 556 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5887
MALGILEPPIGEKAPGTTRYYGEPDAPQGRSSGDDDVPLKCDTRHGDAVILIPQPSDDPNDPLNWPLWKRDVITF
ILCFAGILATSLSSILAANTVVLVMHFQTSLGQAAVLTGYFVLGTGAAAIFFVPSGRVWGKRHLFLVGTCIIIAS
GAWAGAVGRNYGSMAAARAIQGMGAAPFETLLNAAVGDLYFVHQRGVRMAATNLAVFGAAFFTPIVTGKITESMG
WQWTFNLVAIFTAVTLPAVFLFCPETAFRREPRPTVSGVVEQNGRVEKINWAPKSPSSATQHPAGMDDAPMPYPP
GFVAFPTSSAMQPVGDARTPKKSFLQSLSLFDGRKTDERYWVLLLRPFPLLMNPAFVWACLIQGTMIGWTVFIGV
LVAILFIGPPYFWGEVAAGYTYIGPFVGALVGFVLAGLLADSSVKVLTKLNKGIYEPEFRIFLVIPMLILGGIGL
YGFGLTADAISSGRYHYVIPPMFFGFETAGMVIGAVASSLYIVDGYRDITVEAFTLTIIFKNMFSFVLTWYAYDW
VTHTGMRRLMVIIATIQVGVCLLSIPMYIWGKRIRAFFHRHDPLAMTRLR
Coding >Ophio5|5887
ATGGCACTGGGGATTCTCGAACCCCCGATCGGCGAAAAGGCCCCGGGCACCACACGGTATTATGGCGAGCCCGAT
GCGCCCCAGGGCAGAAGCAGTGGCGACGACGATGTCCCGCTGAAATGCGACACTCGTCACGGCGATGCTGTCATC
CTTATCCCCCAGCCGTCCGACGACCCGAATGATCCCCTCAACTGGCCGCTCTGGAAGCGCGACGTCATCACATTT
ATCCTCTGCTTCGCTGGCATCTTGGCGACGTCGCTGAGTTCGATTCTGGCCGCCAACACCGTCGTCCTCGTCATG
CACTTTCAAACCAGCCTCGGCCAGGCCGCGGTGCTGACGGGTTATTTCGTTCTCGGCACCGGAGCGGCTGCCATC
TTCTTCGTCCCTTCGGGCCGTGTCTGGGGGAAGCGTCATCTTTTCCTGGTCGGCACTTGCATCATCATCGCCTCT
GGTGCCTGGGCTGGCGCCGTGGGGCGAAACTACGGAAGCATGGCTGCTGCCAGGGCCATTCAGGGCATGGGAGCG
GCTCCCTTTGAGACGCTGCTCAACGCTGCCGTCGGTGACCTCTATTTCGTCCATCAGAGAGGCGTGCGCATGGCG
GCCACCAACCTCGCCGTCTTCGGCGCCGCCTTCTTTACCCCCATCGTCACCGGTAAGATCACCGAGTCGATGGGC
TGGCAATGGACCTTTAACTTGGTGGCCATCTTCACCGCCGTCACCTTGCCTGCCGTCTTCCTCTTTTGTCCCGAG
ACGGCCTTTCGTCGGGAGCCAAGGCCGACGGTAAGCGGCGTCGTCGAACAGAACGGCCGTGTCGAAAAGATCAAT
TGGGCGCCCAAGTCGCCCTCGTCGGCCACGCAGCATCCCGCCGGCATGGACGACGCGCCCATGCCCTATCCGCCG
GGCTTCGTCGCCTTCCCCACGTCGTCGGCCATGCAGCCCGTCGGCGACGCCAGGACGCCGAAAAAGTCGTTCCTC
CAATCGCTGTCGCTCTTCGACGGCCGCAAGACGGACGAGCGCTATTGGGTCCTACTGCTACGGCCCTTTCCCCTG
CTCATGAACCCGGCCTTTGTATGGGCCTGCCTGATACAGGGAACCATGATCGGCTGGACCGTCTTCATCGGCGTC
CTCGTCGCCATCCTCTTCATCGGCCCGCCCTACTTTTGGGGCGAGGTGGCGGCCGGATACACGTACATCGGTCCC
TTTGTCGGCGCCCTCGTCGGCTTCGTCCTCGCCGGCCTGCTCGCCGACAGTAGCGTCAAGGTGTTGACGAAGCTT
AACAAGGGCATCTACGAGCCCGAGTTTCGCATCTTTCTCGTCATTCCCATGCTTATCCTCGGCGGCATCGGCCTG
TACGGCTTTGGTCTGACGGCCGACGCCATCTCCTCGGGCCGGTATCACTACGTCATCCCTCCCATGTTCTTTGGC
TTCGAGACGGCGGGCATGGTCATTGGCGCCGTCGCCAGCTCCCTGTATATTGTCGACGGCTATCGCGACATCACC
GTCGAGGCTTTTACTCTCACCATCATCTTCAAAAACATGTTTAGTTTCGTCCTGACCTGGTATGCCTACGACTGG
GTCACGCACACCGGCATGCGCCGCCTCATGGTCATCATCGCCACCATCCAGGTCGGCGTCTGTCTGCTGAGCATT
CCGATGTACATCTGGGGGAAGCGCATCAGAGCCTTCTTCCACCGACACGACCCCCTCGCCATGACGCGCCTACGA
Transcript >Ophio5|5887
ATGGCACTGGGGATTCTCGAACCCCCGATCGGCGAAAAGGCCCCGGGCACCACACGGTATTATGGCGAGCCCGAT
GCGCCCCAGGGCAGAAGCAGTGGCGACGACGATGTCCCGCTGAAATGCGACACTCGTCACGGCGATGCTGTCATC
CTTATCCCCCAGCCGTCCGACGACCCGAATGATCCCCTCAACTGGCCGCTCTGGAAGCGCGACGTCATCACATTT
ATCCTCTGCTTCGCTGGCATCTTGGCGACGTCGCTGAGTTCGATTCTGGCCGCCAACACCGTCGTCCTCGTCATG
CACTTTCAAACCAGCCTCGGCCAGGCCGCGGTGCTGACGGGTTATTTCGTTCTCGGCACCGGAGCGGCTGCCATC
TTCTTCGTCCCTTCGGGCCGTGTCTGGGGGAAGCGTCATCTTTTCCTGGTCGGCACTTGCATCATCATCGCCTCT
GGTGCCTGGGCTGGCGCCGTGGGGCGAAACTACGGAAGCATGGCTGCTGCCAGGGCCATTCAGGGCATGGGAGCG
GCTCCCTTTGAGACGCTGCTCAACGCTGCCGTCGGTGACCTCTATTTCGTCCATCAGAGAGGCGTGCGCATGGCG
GCCACCAACCTCGCCGTCTTCGGCGCCGCCTTCTTTACCCCCATCGTCACCGGTAAGATCACCGAGTCGATGGGC
TGGCAATGGACCTTTAACTTGGTGGCCATCTTCACCGCCGTCACCTTGCCTGCCGTCTTCCTCTTTTGTCCCGAG
ACGGCCTTTCGTCGGGAGCCAAGGCCGACGGTAAGCGGCGTCGTCGAACAGAACGGCCGTGTCGAAAAGATCAAT
TGGGCGCCCAAGTCGCCCTCGTCGGCCACGCAGCATCCCGCCGGCATGGACGACGCGCCCATGCCCTATCCGCCG
GGCTTCGTCGCCTTCCCCACGTCGTCGGCCATGCAGCCCGTCGGCGACGCCAGGACGCCGAAAAAGTCGTTCCTC
CAATCGCTGTCGCTCTTCGACGGCCGCAAGACGGACGAGCGCTATTGGGTCCTACTGCTACGGCCCTTTCCCCTG
CTCATGAACCCGGCCTTTGTATGGGCCTGCCTGATACAGGGAACCATGATCGGCTGGACCGTCTTCATCGGCGTC
CTCGTCGCCATCCTCTTCATCGGCCCGCCCTACTTTTGGGGCGAGGTGGCGGCCGGATACACGTACATCGGTCCC
TTTGTCGGCGCCCTCGTCGGCTTCGTCCTCGCCGGCCTGCTCGCCGACAGTAGCGTCAAGGTGTTGACGAAGCTT
AACAAGGGCATCTACGAGCCCGAGTTTCGCATCTTTCTCGTCATTCCCATGCTTATCCTCGGCGGCATCGGCCTG
TACGGCTTTGGTCTGACGGCCGACGCCATCTCCTCGGGCCGGTATCACTACGTCATCCCTCCCATGTTCTTTGGC
TTCGAGACGGCGGGCATGGTCATTGGCGCCGTCGCCAGCTCCCTGTATATTGTCGACGGCTATCGCGACATCACC
GTCGAGGCTTTTACTCTCACCATCATCTTCAAAAACATGTTTAGTTTCGTCCTGACCTGGTATGCCTACGACTGG
GTCACGCACACCGGCATGCGCCGCCTCATGGTCATCATCGCCACCATCCAGGTCGGCGTCTGTCTGCTGAGCATT
CCGATGTACATCTGGGGGAAGCGCATCAGAGCCTTCTTCCACCGACACGACCCCCTCGCCATGACGCGCCTACGA
TGA
Gene >Ophio5|5887
ATGGCACTGGGGATTCTCGAACCCCCGATCGGCGAAAAGGCCCCGGGTATTGTCTAGAGCGACTGCCCCCTCCCC
CTTCCCCCAATACTCCCTTGTTGGTCGCTGACGCTGACGGATTTGCTTCCGTCTAGGCACCACACGGTATTATGG
CGAGCCCGATGCGCCCCAGGGCAGAAGCAGTGGCGACGACGATGTCCCGCTGAAATGCGACACTCGTCACGGCGA
TGCTGTCATCCTTGTGCGCGGCTCACGCCCCCCTCTCTTAGTCTTGTCACTGACAACGTGGGCTCTCGTCGCAGA
TCCCCCAGCCGTCCGACGACCCGAATGATCCCCTCAACTGGCCGCTCTGGAAGCGCGACGTCATCACATTTATCC
TCTGCTTCGCTGGCATCTTGGCGACGTCGCTGAGTTCGATTCTGGCCGCCAACACCGTCGTCCTCGTCATGCACT
TTCAAACCAGCCTCGGCCAGGCCGCGGTGCTGACGGGTTATTTCGTTCTCGGCACCGGAGCGGCTGCCATCTTCT
TCGTCCCTTCGGGCCGTGTCTGGGGGAAGCGTCATCTTTTCCTGGTCGGCACTTGCATCATCATCGCCTCTGGTG
CCTGGGCTGGCGCCGTGGGGCGAAACTACGGAAGCATGGCTGCTGCCAGGGCCATTCAGGGCATGGGAGCGGCTC
CCTTTGAGACGCTGCTCAACGCTGCCGTCGGTGACCTCTATTTCGTCCATCAGAGAGGCGTGCGCATGGCGGCCA
CCAACCTCGCCGTCTTCGGCGCCGCCTTCTTTACCCCCATCGTCACCGGTAAGATCACCGAGTCGATGGGCTGGC
AATGGACCTTTAACTTGGTGGCCATCTTCACCGCCGTCACCTTGCCTGCCGTCTTCCTCTTTTGTCCCGAGACGG
CCTTTCGTCGGGAGCCAAGGCCGACGGTAAGCGGCGTCGTCGAACAGAACGGCCGTGTCGAAAAGATCAATTGGG
CGCCCAAGTCGCCCTCGTCGGCCACGCAGCATCCCGCCGGCATGGACGACGCGCCCATGCCCTATCCGCCGGGCT
TCGTCGCCTTCCCCACGTCGTCGGCCATGCAGCCCGTCGGCGACGCCAGGACGCCGAAAAAGTCGTTCCTCCAAT
CGCTGTCGCTCTTCGACGGCCGCAAGACGGACGAGCGCTATTGGGTCCTACTGCTACGGCCCTTTCCCCTGCTCA
TGAACCCGGCCTTTGTATGGGCCTGCCTGATACAGGGAACCATGATCGGCTGGACCGTCTTCATCGGCGTCCTCG
TCGCCATCCTCTTCATCGGCCCGCCCTACTTTTGGGGCGAGGTGGCGGCCGGATACACGTACATCGGTCCCTTTG
TCGGCGCCCTCGTCGGCTTCGTCCTCGCCGGCCTGCTCGCCGACAGTAGCGTCAAGGTGTTGACGAAGCTTAACA
AGGGCATCTACGAGCCCGAGTTTCGCATCTTTCTCGTCATTCCCATGCTTATCCTCGGCGGCATCGGCCTGTACG
GCTTTGGTCTGACGGCCGACGCCATCTCCTCGGGCCGGTATCACTACGTCATCCCTCCCATGTTCTTTGGCTTCG
AGACGGCGGGCATGGTCATTGGCGCCGTCGCCAGCTCCCTGTATATTGTCGACGGCTATCGTGAGTCTGGCCCCT
TGACCTCTGCCGCCTTTTTCCCCTTGCCCTCATCATCTGGGTCGGTGCTGACAGCGCCGGCCGGGACAGGCGACA
TCACCGTCGAGGCTTTTACTCTCACCATCATCTTCAAAAACATGTTTAGTTTCGTCCTGACCTGGTATGCCTACG
ACTGGGTCACGCACACCGGCATGCGCCGCCTCATGGTCATCATCGCCACCATCCAGGTCGGCGTCTGTCTGCTGA
GCATTCCGATGTGTAAGCCAACCAACGTGGCCCAGATTTTTTTTCCTTCCTTCTTTTTTTGGATTTCCCCCTTCT
TTCGAGAGGGATAGGTAGGTTTCCTTTTTTCCAAAAAAACAGGGCTGACTGGCTTGGTTTGTGTAGACATCTGGG
GGAAGCGCATCAGAGCCTTCTTCCACCGACACGACCCCCTCGCCATGACGCGCCTACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail