Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|588
Gene name
Locationscaffold_1151:948..2991
Strand+
Gene length (bp)2043
Transcript length (bp)1764
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 1.0E-114 279 567
PF10348 DUF2427 Domain of unknown function (DUF2427) 3.0E-27 64 160

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 66 572 2.0E-80
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 265 568 1.0E-65

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 77 99 22
2 106 128 22
3 146 168 22
4 274 296 22
5 311 333 22
6 355 377 22
7 382 404 22
8 441 460 19
9 475 497 22
10 510 528 18
11 543 565 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|588
MKSGATHKQDTGHCFMNPPAQLQPFVGTLTLCLLFFRPSLALALGRNSTSGVEDAAPSNDTSSYSESYFTHPDHA
GLIYAHILLMSACWVLVLPVAVVLSLAGSRLTLVSQYWFLALNALGLVLGTIYNSKTPNLYPNNAHGKVGWLISW
VASAQVLLSLMGCTGAIIRSHPSYSKPPISGHLSSDLGTDRDRRLSSDSSQCTESQPKAAHLPPASSSREGGDYE
ALTMHGFDEDQFAMAAQSSPGVSRLPGDKITFVRVWQNIGIIYQLIDRIILPLGFVALATGLATFGRLFEGKAIF
SGLAHWIKGGVFFWLGLFTLGRWAGSFGELGWAWNMPPTTFRRTWRPSAEWMESALIFVYGSTNIFLEHLGGWGG
AWSAQDLEHIAITILFIGGGLCGMLVESAKVRSLLNTTVLEATGDPRSEPNGEGQLQRLDLSTYEFSLNPIPALV
ILLLGIIMSSHQQSTGMSMDIHRQWGFLLSGASITRCLTYILVFLRPPRSTLPSRPPTELLTSFALIAGGIIFMA
SSSDTIKGMMYYNLDSMFLYTVTMGLAGLLMAWVVVVLSIKGWASRREGRLGPRSCGLTRAL
Coding >Ophio5|588
ATGAAATCAGGAGCCACGCACAAGCAAGATACGGGCCACTGCTTCATGAATCCCCCCGCGCAATTGCAACCCTTC
GTCGGGACTTTGACGCTATGTCTATTGTTCTTCCGGCCATCCCTCGCCCTTGCACTGGGACGCAACAGCACTAGC
GGGGTCGAAGATGCAGCTCCCAGCAACGATACATCATCCTATTCGGAATCCTACTTTACCCATCCTGACCATGCT
GGCCTCATATACGCCCATATTCTCCTCATGTCGGCATGTTGGGTTCTGGTCCTGCCCGTCGCTGTCGTGCTGTCG
TTGGCAGGCTCTCGGCTCACGCTTGTGTCACAATACTGGTTTTTAGCCTTGAACGCGCTAGGCCTCGTCCTAGGA
ACCATCTATAACTCCAAGACACCAAATCTGTATCCAAATAATGCCCACGGCAAGGTCGGCTGGCTAATCAGTTGG
GTCGCCTCTGCCCAAGTCCTTTTGAGTCTGATGGGCTGCACGGGAGCAATTATCAGGTCACACCCGTCGTACAGC
AAACCTCCAATCTCCGGACATTTGAGCTCCGACCTTGGTACTGACCGAGATCGCCGATTGTCGAGCGACAGCAGC
CAGTGCACTGAATCCCAACCAAAAGCCGCTCACCTACCTCCAGCCTCTTCCTCAAGAGAAGGCGGCGATTATGAA
GCTCTCACAATGCACGGTTTCGACGAGGATCAATTCGCTATGGCAGCTCAATCATCACCCGGCGTATCGAGGTTG
CCGGGAGACAAGATCACGTTCGTCAGAGTATGGCAAAACATCGGCATCATCTATCAACTAATCGATCGAATTATT
CTGCCTTTGGGATTTGTTGCCTTAGCCACTGGTCTCGCTACATTTGGCCGGCTTTTCGAGGGTAAGGCAATCTTC
AGCGGACTTGCCCATTGGATCAAGGGCGGCGTCTTCTTCTGGCTTGGTCTTTTCACTTTGGGCCGCTGGGCTGGC
AGCTTTGGCGAGCTTGGTTGGGCTTGGAACATGCCTCCGACCACCTTTCGGCGGACGTGGCGTCCGTCAGCTGAG
TGGATGGAGAGCGCCCTCATCTTCGTGTATGGTTCCACCAACATCTTTCTCGAGCATCTCGGCGGTTGGGGGGGG
GCGTGGAGTGCACAAGACCTCGAACACATCGCCATCACTATTCTTTTCATCGGGGGGGGCTTGTGCGGTATGCTG
GTTGAGTCCGCCAAAGTTCGCAGTCTACTTAACACAACTGTACTGGAAGCGACTGGAGACCCACGCTCTGAACCT
AATGGCGAGGGACAATTACAGCGCCTCGACCTGTCAACTTATGAGTTCTCCCTGAATCCGATACCTGCACTCGTG
ATCCTCTTACTCGGCATCATCATGAGCTCGCACCAGCAGTCAACAGGAATGTCAATGGACATCCATAGGCAATGG
GGCTTCCTATTGTCTGGTGCCTCGATTACTCGTTGCCTGACTTATATACTCGTTTTTCTGCGACCACCCCGGTCG
ACTTTACCGTCTCGGCCACCTACTGAGCTGTTGACATCGTTCGCACTCATCGCTGGCGGAATCATCTTCATGGCA
AGTAGTTCAGACACAATTAAAGGTATGATGTACTATAACTTGGACTCTATGTTCCTCTACACTGTTACTATGGGG
CTCGCCGGACTGTTGATGGCTTGGGTGGTGGTTGTACTCTCCATCAAAGGATGGGCCAGTCGCAGGGAGGGGCGT
CTCGGCCCTCGAAGTTGTGGATTAACCAGGGCTCTT
Transcript >Ophio5|588
ATGAAATCAGGAGCCACGCACAAGCAAGATACGGGCCACTGCTTCATGAATCCCCCCGCGCAATTGCAACCCTTC
GTCGGGACTTTGACGCTATGTCTATTGTTCTTCCGGCCATCCCTCGCCCTTGCACTGGGACGCAACAGCACTAGC
GGGGTCGAAGATGCAGCTCCCAGCAACGATACATCATCCTATTCGGAATCCTACTTTACCCATCCTGACCATGCT
GGCCTCATATACGCCCATATTCTCCTCATGTCGGCATGTTGGGTTCTGGTCCTGCCCGTCGCTGTCGTGCTGTCG
TTGGCAGGCTCTCGGCTCACGCTTGTGTCACAATACTGGTTTTTAGCCTTGAACGCGCTAGGCCTCGTCCTAGGA
ACCATCTATAACTCCAAGACACCAAATCTGTATCCAAATAATGCCCACGGCAAGGTCGGCTGGCTAATCAGTTGG
GTCGCCTCTGCCCAAGTCCTTTTGAGTCTGATGGGCTGCACGGGAGCAATTATCAGGTCACACCCGTCGTACAGC
AAACCTCCAATCTCCGGACATTTGAGCTCCGACCTTGGTACTGACCGAGATCGCCGATTGTCGAGCGACAGCAGC
CAGTGCACTGAATCCCAACCAAAAGCCGCTCACCTACCTCCAGCCTCTTCCTCAAGAGAAGGCGGCGATTATGAA
GCTCTCACAATGCACGGTTTCGACGAGGATCAATTCGCTATGGCAGCTCAATCATCACCCGGCGTATCGAGGTTG
CCGGGAGACAAGATCACGTTCGTCAGAGTATGGCAAAACATCGGCATCATCTATCAACTAATCGATCGAATTATT
CTGCCTTTGGGATTTGTTGCCTTAGCCACTGGTCTCGCTACATTTGGCCGGCTTTTCGAGGGTAAGGCAATCTTC
AGCGGACTTGCCCATTGGATCAAGGGCGGCGTCTTCTTCTGGCTTGGTCTTTTCACTTTGGGCCGCTGGGCTGGC
AGCTTTGGCGAGCTTGGTTGGGCTTGGAACATGCCTCCGACCACCTTTCGGCGGACGTGGCGTCCGTCAGCTGAG
TGGATGGAGAGCGCCCTCATCTTCGTGTATGGTTCCACCAACATCTTTCTCGAGCATCTCGGCGGTTGGGGGGGG
GCGTGGAGTGCACAAGACCTCGAACACATCGCCATCACTATTCTTTTCATCGGGGGGGGCTTGTGCGGTATGCTG
GTTGAGTCCGCCAAAGTTCGCAGTCTACTTAACACAACTGTACTGGAAGCGACTGGAGACCCACGCTCTGAACCT
AATGGCGAGGGACAATTACAGCGCCTCGACCTGTCAACTTATGAGTTCTCCCTGAATCCGATACCTGCACTCGTG
ATCCTCTTACTCGGCATCATCATGAGCTCGCACCAGCAGTCAACAGGAATGTCAATGGACATCCATAGGCAATGG
GGCTTCCTATTGTCTGGTGCCTCGATTACTCGTTGCCTGACTTATATACTCGTTTTTCTGCGACCACCCCGGTCG
ACTTTACCGTCTCGGCCACCTACTGAGCTGTTGACATCGTTCGCACTCATCGCTGGCGGAATCATCTTCATGGCA
AGTAGTTCAGACACAATTAAAGGTATGATGTACTATAACTTGGACTCTATGTTCCTCTACACTGTTACTATGGGG
CTCGCCGGACTGTTGATGGCTTGGGTGGTGGTTGTACTCTCCATCAAAGGATGGGCCAGTCGCAGGGAGGGGCGT
CTCGGCCCTCGAAGTTGTGGATTAACCAGGGCTCTTTGA
Gene >Ophio5|588
ATGAAATCAGGAGCCACGCACAAGCAAGATACGGGCCACTGCTTCATGAATCCCCCCGCGCAATTGCAACCCTTC
GTCGGGACTTTGACGCTATGTCTATTGTTCTTCCGGCCATCCCTCGCCCTTGCACTGGGACGCAACAGCACTAGC
GGGGTCGAAGATGCAGCTCCCAGCAACGATACATCATCCTATTCGGAATCCTACTTTACCCATCCTGACCATGCT
GGCCTCATATACGCCCATATTCTCCTCATGTCGGCATGTTGGGTTCTGGTCCTGCCCGTCGGTACGTGACGTCAC
TCTCCTCACCAAAGCGTTGTCTATGGACCTGATCTTTCATTCTCATCTTGTTCCTCTAGCTGTCGTGCTGTCGTT
GGCAGGCTCTCGGCTCACGCTTGTGTCACAATACTGGTTTTTAGCCTTGAACGCGCTAGGCCTCGTCCTAGGAAC
CATCTATAACTCCAAGACACCAAATCTGTATCCAAATAATGCCCACGGCAAGGTCGGCTGGCTAATCAGTTGGGT
CGCCTCTGCCCAAGTCCTTTTGAGTCTGATGGGCTGCACGGGAGCAATTATCAGGTCACACCCGTCGTACAGCAA
ACCTCCAATCTCCGGACATTTGAGCTCCGACCTTGGTACTGACCGAGATCGCCGATTGTCGAGCGACAGCAGCCA
GTGCACTGAATCCCAACCAAAAGCCGCTCACCTACCTCCAGCCTCTTCCTCAAGAGAAGGCGGCGATTATGAAGC
TCTCACAATGCACGGTTTCGACGAGGATCAATTCGCTATGGCAGCTCAATCATCACCCGGCGTATCGAGGTTGCC
GGGAGACAAGATCACGTTCGTCAGAGTATGGCAAAACATCGGCATCATCTATCAACTAATCGATCGAATTATTCT
GCCTTTGGGATTTGTTGCCTTAGCCACTGGTCTCGCTACATTTGGCCGGCTTTTCGTAAGTTACAGCCACTGTTT
TTGCAGCCGAGAGCCACAAAAGTCTCGTCGCTAATGTCTGGCTTGTAAAATGATAGGAGGGTAAGGCAATCTTCA
GCGGACTTGCCCATTGGATCAAGGGCGGCGTCTTCTTCTGGCTTGGTCTTTTCACTTTGGGCCGCTGGGCTGGCA
GCTTTGGCGAGCTTGGTTGGGCTTGGAACATGCCTCCGACCACCTTTCGGCGGACGTGGCGTCCGTCAGCTGAGT
GGATGGAGAGCGCCCTCATCTTCGTGTATGGTTCCACCAACATCTTTCTCGAGCATCTCGGCGGTTGGGGGGGGG
CGTGGAGTGCACAAGACCTCGAACACATCGCCATCACTATTCTTTTCATCGGGGGGGGCTTGGTAAGCACTAGCA
ATGTCTTCTGGAAATACCAAATTAAGCAGCTGACATTGAAATGTGCCAGTGCGGTATGCTGGTTGAGTCCGCCAA
AGTTCGCAGTCTACTTAACACAACTGTACTGGAAGCGACTGGAGACCCACGCTCTGAACCTAATGGCGAGGGACA
ATTACAGCGCCTCGACCTGTCAACTTATGAGTTCTCCCTGAATCCGATACCTGCACTCGTGATCCTCTTACTCGG
CATCATCATGAGCTCGCACCAGCAGTCAACAGGAATGTCAATGGACATCCATAGGCAATGGGGCTTCCTATTGTC
TGGTGCCTCGATTACTCGTTGCCTGACTTATATACTCGTTTTTCTGCGACCACCCCGGTCGACTTTACCGTCTCG
GCCACCTACTGAGCTGTTGACATCGTTCGCACTCATCGCTGGCGGAATCATCTTCATGGCAAGTGTAGGTGCTCT
CTCCCGAGTGGATATGTGCCTTACCTCTCCCGCCGAGCGGCGACTTACGAGCCATAGAGTTCAGACACAATTAAA
GGTATGATGTACTATAACTTGGACTCTATGTTCCTCTACACTGTTACTATGGGGCTCGCCGGACTGTTGATGGCT
TGGGTGGTGGTTGTACTCTCCATCAAAGGATGGGCCAGTCGCAGGGAGGGGCGTCTCGGCCCTCGAAGTTGTGGA
TTAACCAGGGCTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail