Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5876
Gene name
Locationscaffold_495:5663..10526
Strand+
Gene length (bp)4863
Transcript length (bp)4692
Coding sequence length (bp)4689
Protein length (aa) 1563

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12816 Vps8 Golgi CORVET complex core vacuolar protein 8 1.1E-71 696 896

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0P5W1|VPS8_MOUSE Vacuolar protein sorting-associated protein 8 homolog OS=Mus musculus GN=Vps8 PE=1 SV=1 141 1426 1.0E-90
sp|Q8N3P4|VPS8_HUMAN Vacuolar protein sorting-associated protein 8 homolog OS=Homo sapiens GN=VPS8 PE=1 SV=3 141 1426 2.0E-86
sp|P39702|VPS8_YEAST Vacuolar protein sorting-associated protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS8 PE=1 SV=2 169 1448 4.0E-81
sp|O13756|VPS8_SCHPO Vacuolar protein sorting-associated protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps8 PE=3 SV=1 150 320 2.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4058 0.5251 0.1291 0.0231 0.1142 0.0153 0.0795 0.4354 0.2497 0.0183

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3814
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|778
Ophiocordyceps australis map64 (Brazil) OphauB2|4399
Ophiocordyceps camponoti-floridani Ophcf2|02265
Ophiocordyceps camponoti-rufipedis Ophun1|3093
Ophiocordyceps kimflemingae Ophio5|5876 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7481

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5876
MSDPEDKSPARDEGLDDVDADVLQMKTHQDLETPDASPRPSARSRRRTGSVLSSANASLVDALPRRAGSPVDSLA
SGAGNTPSLQGSLMSSPGSSVLPSVASRPGLGSPSPSLRPFDRRFHSRYSPSPSSSPRGSSPAFLSGHSRNVSLA
SNFPLDQADTDTPSAPWEVVRWTRLNKLNGNAFSELGRRNFGSPTCIAVSASIVLGTSKGIILMFDYHQNIKMII
GQGTPAVESGAVTSIAVSADHTTIAGGHANGNIFTWDTSRAARPFLSIPHLHESQVQNLAADGHVPNVSVIHLGF
LGTRHTALVSADDRGMAFSHLATRGTGALGRTVKTTRILGRYPGAPTPAGKPLKPSTVLSFAPLPLGNVERATDT
MGLTAMLTPYLLVVVSTTPVARTQHKSARPREVPAHSAMTGCLAWFPAVRLKVPDSVSGSDVSKAKLVYCWSNVL
TVLDVDEMPSEDADQPSSLKFKARSRWKCEEAIVAVQWLTRSVLTVLTISQRLIVLEDGSLRMTEAFDLLQKHIY
HTDLFSKQLHNLVEQLDNDDESMHGVVADAFYMSFKAYKGRIFLLGFGEVAIGALANWADRLIAMMEHGDYVGAI
RLATSYYTGDADKLTIGLPEDAKLRHAMVQDKIMEIMAASLKYAFGQRLRNSDNADDNQLRRLAEACFAACQAID
TIDYLFDDVYERYETAAVGAVFHETLEPYVLDGSITSVPPAVVKDMVVYYVSRGWEGRLEELICHMQTATFDLDQ
MTSLCKENSLYDALIYVWNQALGDYISPMMDLLSLLVPLTTNGQHTTGASVDYYSVNALKIFPYLSYVLTSRAYP
SGERMDDGAASRAKSDIYWFFFSGKTIEWPRGSGRQLLTRPAGEDEPAFPYLRMVLKFDAPSFLSALNEAFEDGF
LNDSPDRQVNGGARVDMPEEQIFGLTINRQYIVTILVDVMSPESFAPEDTVYLDMFIARNLPKFPQYLLFSGSTL
SRVLSKLCSYPGEDLAEDAQLSAEYLLSVYQPSDMSALMPLFKKAGFYRILKRIYKVEKQYGKLVATYFEDADDQ
DAVFDAISDCLLHRGGVDDRRRREVLQVVEERAGDLLMLSPRRAAATLASQGPAFHARIVGSAEDGPELQFAYLK
ALLEPDEGAREQAVAPDRQLVENYVRLMCQFEPLRVSDYVGAVQFADLRLEELLPTMEATGVVDAAVVLMARDGQ
AEKALERLVRHLFTLESVVQGLLGGADERVDAAHDSVEDVLRGMQRYVYVGIWLCQGQSKMSKQRAVAVQKNKPE
THADEALWVSLIDACVQVTKQLSPALQGLADGAKLVTLLRSLVQHTFTSLLKTTTGQAHEQQASKLLSNAGANLS
FLRIMRAFLTRAAASSPDVADLREVLSSIFAAYAYEESILKLSNRLLERSLFVSVKQAVDLRQRGWRPRGSTCEA
CGRRVWGPGVAGGAVLEAWEERQALEEARRRDRRDRNARANKGEGGEGAVNGKDKGKSPDRRFAETEMAKPDAIT
EADGIADGSGSKEPASGPLVVLACRHIFHISCLEALQDGRENGGTVRDRGFKCPVDGGGMTRP
Coding >Ophio5|5876
ATGTCTGACCCAGAAGACAAGTCTCCGGCGCGAGACGAAGGCCTCGACGATGTGGACGCCGATGTGCTCCAGATG
AAGACGCACCAAGACCTGGAGACGCCCGATGCGAGCCCACGACCGTCGGCCCGGTCGCGGCGCCGGACCGGCTCC
GTGCTGAGCTCGGCGAACGCGAGCTTGGTGGATGCGCTGCCGAGAAGAGCCGGCAGTCCTGTCGACTCGCTGGCT
TCTGGTGCGGGAAACACGCCTTCTCTGCAGGGATCTCTCATGTCCTCTCCGGGGAGCAGCGTTCTCCCCTCGGTA
GCCTCTCGCCCGGGTCTCGGCAGCCCGTCGCCTTCTTTGCGGCCTTTTGATCGACGTTTTCACTCGCGGTATTCG
CCCTCGCCATCGAGCAGTCCGCGCGGCTCGTCGCCCGCCTTCCTTTCGGGCCACAGCCGGAACGTGTCACTGGCT
TCCAACTTCCCGCTCGACCAGGCCGATACGGATACGCCGTCTGCGCCGTGGGAGGTGGTGCGATGGACTCGGCTC
AATAAACTCAATGGCAATGCCTTTTCGGAGCTGGGCCGGCGCAACTTTGGCTCGCCGACTTGCATTGCTGTGTCG
GCTTCCATTGTGCTGGGGACGTCTAAAGGAATAATCTTAATGTTTGATTACCACCAGAATATCAAGATGATCATT
GGCCAAGGCACGCCAGCTGTCGAGTCCGGCGCCGTCACGTCCATCGCCGTCTCCGCCGACCATACCACCATCGCA
GGTGGCCACGCCAATGGCAACATCTTCACCTGGGACACTTCGCGAGCGGCGCGGCCCTTCCTTTCCATCCCTCAT
CTGCATGAGTCTCAGGTGCAGAACCTCGCGGCCGACGGCCACGTCCCAAACGTCTCCGTCATCCATCTGGGATTT
CTGGGGACCCGGCATACGGCCCTAGTTTCAGCCGACGATCGAGGCATGGCCTTCTCACACCTCGCGACCAGGGGC
ACCGGCGCGCTCGGCAGGACCGTCAAGACGACCAGGATCCTGGGCCGATATCCAGGCGCGCCGACGCCGGCTGGG
AAGCCATTGAAACCGAGCACCGTCCTCTCTTTTGCTCCTCTGCCGCTCGGCAACGTAGAGCGTGCTACCGACACC
ATGGGCTTGACCGCAATGCTCACCCCTTACCTGCTCGTCGTCGTGTCGACGACGCCGGTGGCCCGTACGCAGCAC
AAGTCGGCTCGGCCTAGAGAGGTTCCCGCCCATAGCGCCATGACCGGCTGCCTCGCCTGGTTCCCGGCCGTGAGA
CTCAAGGTGCCGGATTCTGTTTCCGGCAGCGACGTGTCCAAGGCCAAGCTCGTCTACTGCTGGTCTAACGTGCTG
ACGGTGCTCGACGTGGACGAGATGCCGAGTGAGGACGCTGATCAGCCTTCCTCGCTCAAGTTCAAGGCCCGCAGC
CGGTGGAAGTGCGAGGAGGCCATCGTCGCCGTGCAATGGCTGACCCGCTCCGTCCTGACGGTGCTCACTATATCT
CAGAGGCTGATTGTGCTGGAGGACGGGAGCTTGCGGATGACCGAGGCTTTTGATTTGCTGCAGAAACACATCTAC
CACACCGATCTGTTTTCCAAGCAGCTCCACAACCTGGTTGAGCAGCTCGACAACGACGACGAATCCATGCACGGC
GTCGTAGCTGATGCCTTCTATATGAGCTTCAAGGCCTACAAGGGCAGGATCTTTCTGCTTGGCTTCGGTGAGGTC
GCCATCGGCGCCCTCGCCAACTGGGCGGACCGCCTCATTGCCATGATGGAACACGGCGACTACGTAGGCGCCATC
CGCCTGGCGACGTCTTACTACACGGGCGACGCCGACAAGCTCACCATTGGCCTGCCCGAGGACGCGAAGCTGCGG
CACGCCATGGTTCAGGACAAGATCATGGAGATTATGGCGGCCTCGCTCAAGTACGCCTTCGGCCAGAGGCTCAGG
AACAGCGACAATGCCGACGACAATCAGCTTCGCCGGCTCGCCGAAGCTTGCTTTGCCGCCTGTCAGGCGATCGAT
ACGATCGATTACCTCTTCGACGACGTGTATGAACGATACGAGACGGCCGCCGTCGGGGCAGTCTTCCATGAGACG
CTGGAGCCTTATGTCCTTGATGGGTCCATCACGTCGGTGCCGCCGGCCGTGGTCAAGGACATGGTCGTCTACTAC
GTATCGCGGGGCTGGGAGGGCCGGCTAGAGGAGCTCATCTGCCACATGCAGACGGCTACCTTTGACTTGGACCAG
ATGACGTCTCTCTGCAAGGAGAACAGCCTGTACGATGCGCTCATCTACGTCTGGAACCAAGCGCTGGGCGACTAC
ATCAGCCCGATGATGGACCTCCTGAGCTTGCTGGTGCCGCTGACGACGAACGGACAGCATACGACGGGAGCATCG
GTGGACTACTACAGCGTCAACGCGCTCAAGATCTTTCCCTACCTGTCGTACGTCCTGACGAGCCGGGCCTATCCG
AGCGGGGAACGGATGGACGACGGGGCAGCATCCAGGGCCAAGTCGGACATCTACTGGTTCTTCTTTTCCGGCAAG
ACCATTGAGTGGCCGAGGGGCAGTGGCCGGCAACTGTTGACGCGACCCGCAGGCGAGGACGAACCGGCGTTTCCC
TACTTGCGGATGGTGCTCAAGTTTGACGCGCCCAGCTTCCTGAGCGCGCTGAACGAGGCGTTCGAGGACGGTTTC
CTGAACGACTCGCCCGATAGGCAGGTCAACGGCGGGGCGCGCGTGGACATGCCAGAGGAGCAAATCTTTGGTCTG
ACCATTAACCGCCAGTACATCGTGACGATCCTCGTCGACGTCATGAGCCCGGAGAGCTTCGCGCCCGAGGACACC
GTCTACCTCGACATGTTCATCGCTCGCAATCTGCCCAAGTTTCCGCAGTATCTTTTGTTCTCTGGCTCGACGCTC
TCCCGGGTGCTGTCCAAACTGTGCTCGTACCCGGGCGAGGACCTGGCCGAGGATGCCCAGCTCAGCGCCGAATAC
CTTTTGTCGGTCTACCAACCTTCCGACATGTCGGCCCTGATGCCGCTCTTTAAGAAGGCGGGCTTCTACCGCATC
CTCAAGCGCATCTACAAGGTAGAGAAGCAGTACGGCAAGCTCGTGGCCACATACTTTGAAGACGCTGATGATCAG
GATGCGGTCTTTGACGCCATCTCGGATTGCCTTTTGCACCGTGGCGGTGTCGACGATCGTCGACGGCGTGAAGTG
CTTCAAGTCGTCGAGGAGCGGGCCGGTGATCTCCTCATGCTGAGCCCGAGGCGGGCGGCGGCCACTCTCGCGTCG
CAAGGGCCCGCCTTCCACGCTCGCATCGTCGGCTCGGCGGAAGACGGGCCGGAACTGCAGTTCGCGTACCTCAAG
GCCTTGCTTGAGCCTGACGAGGGGGCGCGCGAACAGGCCGTGGCGCCCGACCGGCAACTGGTGGAAAACTACGTC
CGTCTCATGTGTCAGTTCGAGCCCCTGCGCGTCTCCGACTACGTCGGCGCTGTGCAGTTTGCGGACCTCCGCCTG
GAGGAGCTGTTGCCGACCATGGAGGCTACGGGCGTCGTCGATGCTGCCGTCGTGCTCATGGCGCGCGACGGCCAG
GCCGAGAAGGCGCTCGAGCGGCTGGTCAGGCATCTTTTCACTCTCGAGTCTGTCGTCCAGGGCCTCCTGGGCGGC
GCCGACGAGCGTGTCGATGCCGCCCACGATTCGGTGGAGGATGTGCTTCGCGGGATGCAGAGATACGTCTACGTC
GGCATCTGGCTGTGCCAAGGGCAATCTAAGATGTCCAAGCAGAGGGCGGTCGCCGTCCAGAAGAACAAGCCAGAG
ACGCACGCGGACGAGGCCCTGTGGGTGAGTCTCATCGACGCCTGCGTTCAAGTAACGAAGCAACTGTCTCCGGCA
CTGCAAGGGCTCGCCGACGGCGCGAAGCTTGTGACGCTCCTCCGGTCACTCGTCCAGCATACCTTTACCTCGCTG
CTCAAGACGACGACCGGCCAGGCGCACGAGCAGCAGGCCAGCAAGCTCTTATCCAACGCCGGGGCGAACCTCTCC
TTCCTGCGAATCATGAGGGCTTTTCTCACGCGGGCGGCCGCCTCGTCGCCGGACGTGGCCGACCTGCGCGAGGTG
CTCTCGTCCATCTTCGCCGCCTACGCGTACGAGGAGTCGATCCTCAAGCTATCGAACCGGCTACTCGAGCGGAGC
CTCTTTGTCAGCGTCAAGCAGGCCGTCGACCTGAGGCAGCGCGGCTGGCGGCCACGGGGCTCTACGTGCGAGGCT
TGTGGGAGGAGGGTCTGGGGGCCTGGCGTGGCGGGCGGCGCCGTTCTCGAGGCCTGGGAGGAGAGGCAGGCGCTC
GAGGAGGCGAGGAGGAGGGATCGGAGGGATCGCAATGCGAGGGCCAACAAGGGCGAGGGTGGCGAGGGCGCTGTC
AACGGGAAGGATAAGGGGAAAAGCCCGGACAGACGGTTTGCGGAGACGGAGATGGCCAAACCGGATGCGATAACC
GAGGCGGACGGTATCGCCGACGGTAGCGGCAGCAAGGAGCCGGCTTCGGGGCCGTTGGTGGTACTGGCATGCCGG
CACATCTTCCATATAAGCTGCCTCGAAGCGCTGCAGGACGGGCGGGAGAATGGGGGCACGGTCAGGGATAGGGGG
TTCAAGTGCCCTGTCGACGGAGGAGGGATGACGAGACCA
Transcript >Ophio5|5876
ATGTCTGACCCAGAAGACAAGTCTCCGGCGCGAGACGAAGGCCTCGACGATGTGGACGCCGATGTGCTCCAGATG
AAGACGCACCAAGACCTGGAGACGCCCGATGCGAGCCCACGACCGTCGGCCCGGTCGCGGCGCCGGACCGGCTCC
GTGCTGAGCTCGGCGAACGCGAGCTTGGTGGATGCGCTGCCGAGAAGAGCCGGCAGTCCTGTCGACTCGCTGGCT
TCTGGTGCGGGAAACACGCCTTCTCTGCAGGGATCTCTCATGTCCTCTCCGGGGAGCAGCGTTCTCCCCTCGGTA
GCCTCTCGCCCGGGTCTCGGCAGCCCGTCGCCTTCTTTGCGGCCTTTTGATCGACGTTTTCACTCGCGGTATTCG
CCCTCGCCATCGAGCAGTCCGCGCGGCTCGTCGCCCGCCTTCCTTTCGGGCCACAGCCGGAACGTGTCACTGGCT
TCCAACTTCCCGCTCGACCAGGCCGATACGGATACGCCGTCTGCGCCGTGGGAGGTGGTGCGATGGACTCGGCTC
AATAAACTCAATGGCAATGCCTTTTCGGAGCTGGGCCGGCGCAACTTTGGCTCGCCGACTTGCATTGCTGTGTCG
GCTTCCATTGTGCTGGGGACGTCTAAAGGAATAATCTTAATGTTTGATTACCACCAGAATATCAAGATGATCATT
GGCCAAGGCACGCCAGCTGTCGAGTCCGGCGCCGTCACGTCCATCGCCGTCTCCGCCGACCATACCACCATCGCA
GGTGGCCACGCCAATGGCAACATCTTCACCTGGGACACTTCGCGAGCGGCGCGGCCCTTCCTTTCCATCCCTCAT
CTGCATGAGTCTCAGGTGCAGAACCTCGCGGCCGACGGCCACGTCCCAAACGTCTCCGTCATCCATCTGGGATTT
CTGGGGACCCGGCATACGGCCCTAGTTTCAGCCGACGATCGAGGCATGGCCTTCTCACACCTCGCGACCAGGGGC
ACCGGCGCGCTCGGCAGGACCGTCAAGACGACCAGGATCCTGGGCCGATATCCAGGCGCGCCGACGCCGGCTGGG
AAGCCATTGAAACCGAGCACCGTCCTCTCTTTTGCTCCTCTGCCGCTCGGCAACGTAGAGCGTGCTACCGACACC
ATGGGCTTGACCGCAATGCTCACCCCTTACCTGCTCGTCGTCGTGTCGACGACGCCGGTGGCCCGTACGCAGCAC
AAGTCGGCTCGGCCTAGAGAGGTTCCCGCCCATAGCGCCATGACCGGCTGCCTCGCCTGGTTCCCGGCCGTGAGA
CTCAAGGTGCCGGATTCTGTTTCCGGCAGCGACGTGTCCAAGGCCAAGCTCGTCTACTGCTGGTCTAACGTGCTG
ACGGTGCTCGACGTGGACGAGATGCCGAGTGAGGACGCTGATCAGCCTTCCTCGCTCAAGTTCAAGGCCCGCAGC
CGGTGGAAGTGCGAGGAGGCCATCGTCGCCGTGCAATGGCTGACCCGCTCCGTCCTGACGGTGCTCACTATATCT
CAGAGGCTGATTGTGCTGGAGGACGGGAGCTTGCGGATGACCGAGGCTTTTGATTTGCTGCAGAAACACATCTAC
CACACCGATCTGTTTTCCAAGCAGCTCCACAACCTGGTTGAGCAGCTCGACAACGACGACGAATCCATGCACGGC
GTCGTAGCTGATGCCTTCTATATGAGCTTCAAGGCCTACAAGGGCAGGATCTTTCTGCTTGGCTTCGGTGAGGTC
GCCATCGGCGCCCTCGCCAACTGGGCGGACCGCCTCATTGCCATGATGGAACACGGCGACTACGTAGGCGCCATC
CGCCTGGCGACGTCTTACTACACGGGCGACGCCGACAAGCTCACCATTGGCCTGCCCGAGGACGCGAAGCTGCGG
CACGCCATGGTTCAGGACAAGATCATGGAGATTATGGCGGCCTCGCTCAAGTACGCCTTCGGCCAGAGGCTCAGG
AACAGCGACAATGCCGACGACAATCAGCTTCGCCGGCTCGCCGAAGCTTGCTTTGCCGCCTGTCAGGCGATCGAT
ACGATCGATTACCTCTTCGACGACGTGTATGAACGATACGAGACGGCCGCCGTCGGGGCAGTCTTCCATGAGACG
CTGGAGCCTTATGTCCTTGATGGGTCCATCACGTCGGTGCCGCCGGCCGTGGTCAAGGACATGGTCGTCTACTAC
GTATCGCGGGGCTGGGAGGGCCGGCTAGAGGAGCTCATCTGCCACATGCAGACGGCTACCTTTGACTTGGACCAG
ATGACGTCTCTCTGCAAGGAGAACAGCCTGTACGATGCGCTCATCTACGTCTGGAACCAAGCGCTGGGCGACTAC
ATCAGCCCGATGATGGACCTCCTGAGCTTGCTGGTGCCGCTGACGACGAACGGACAGCATACGACGGGAGCATCG
GTGGACTACTACAGCGTCAACGCGCTCAAGATCTTTCCCTACCTGTCGTACGTCCTGACGAGCCGGGCCTATCCG
AGCGGGGAACGGATGGACGACGGGGCAGCATCCAGGGCCAAGTCGGACATCTACTGGTTCTTCTTTTCCGGCAAG
ACCATTGAGTGGCCGAGGGGCAGTGGCCGGCAACTGTTGACGCGACCCGCAGGCGAGGACGAACCGGCGTTTCCC
TACTTGCGGATGGTGCTCAAGTTTGACGCGCCCAGCTTCCTGAGCGCGCTGAACGAGGCGTTCGAGGACGGTTTC
CTGAACGACTCGCCCGATAGGCAGGTCAACGGCGGGGCGCGCGTGGACATGCCAGAGGAGCAAATCTTTGGTCTG
ACCATTAACCGCCAGTACATCGTGACGATCCTCGTCGACGTCATGAGCCCGGAGAGCTTCGCGCCCGAGGACACC
GTCTACCTCGACATGTTCATCGCTCGCAATCTGCCCAAGTTTCCGCAGTATCTTTTGTTCTCTGGCTCGACGCTC
TCCCGGGTGCTGTCCAAACTGTGCTCGTACCCGGGCGAGGACCTGGCCGAGGATGCCCAGCTCAGCGCCGAATAC
CTTTTGTCGGTCTACCAACCTTCCGACATGTCGGCCCTGATGCCGCTCTTTAAGAAGGCGGGCTTCTACCGCATC
CTCAAGCGCATCTACAAGGTAGAGAAGCAGTACGGCAAGCTCGTGGCCACATACTTTGAAGACGCTGATGATCAG
GATGCGGTCTTTGACGCCATCTCGGATTGCCTTTTGCACCGTGGCGGTGTCGACGATCGTCGACGGCGTGAAGTG
CTTCAAGTCGTCGAGGAGCGGGCCGGTGATCTCCTCATGCTGAGCCCGAGGCGGGCGGCGGCCACTCTCGCGTCG
CAAGGGCCCGCCTTCCACGCTCGCATCGTCGGCTCGGCGGAAGACGGGCCGGAACTGCAGTTCGCGTACCTCAAG
GCCTTGCTTGAGCCTGACGAGGGGGCGCGCGAACAGGCCGTGGCGCCCGACCGGCAACTGGTGGAAAACTACGTC
CGTCTCATGTGTCAGTTCGAGCCCCTGCGCGTCTCCGACTACGTCGGCGCTGTGCAGTTTGCGGACCTCCGCCTG
GAGGAGCTGTTGCCGACCATGGAGGCTACGGGCGTCGTCGATGCTGCCGTCGTGCTCATGGCGCGCGACGGCCAG
GCCGAGAAGGCGCTCGAGCGGCTGGTCAGGCATCTTTTCACTCTCGAGTCTGTCGTCCAGGGCCTCCTGGGCGGC
GCCGACGAGCGTGTCGATGCCGCCCACGATTCGGTGGAGGATGTGCTTCGCGGGATGCAGAGATACGTCTACGTC
GGCATCTGGCTGTGCCAAGGGCAATCTAAGATGTCCAAGCAGAGGGCGGTCGCCGTCCAGAAGAACAAGCCAGAG
ACGCACGCGGACGAGGCCCTGTGGGTGAGTCTCATCGACGCCTGCGTTCAAGTAACGAAGCAACTGTCTCCGGCA
CTGCAAGGGCTCGCCGACGGCGCGAAGCTTGTGACGCTCCTCCGGTCACTCGTCCAGCATACCTTTACCTCGCTG
CTCAAGACGACGACCGGCCAGGCGCACGAGCAGCAGGCCAGCAAGCTCTTATCCAACGCCGGGGCGAACCTCTCC
TTCCTGCGAATCATGAGGGCTTTTCTCACGCGGGCGGCCGCCTCGTCGCCGGACGTGGCCGACCTGCGCGAGGTG
CTCTCGTCCATCTTCGCCGCCTACGCGTACGAGGAGTCGATCCTCAAGCTATCGAACCGGCTACTCGAGCGGAGC
CTCTTTGTCAGCGTCAAGCAGGCCGTCGACCTGAGGCAGCGCGGCTGGCGGCCACGGGGCTCTACGTGCGAGGCT
TGTGGGAGGAGGGTCTGGGGGCCTGGCGTGGCGGGCGGCGCCGTTCTCGAGGCCTGGGAGGAGAGGCAGGCGCTC
GAGGAGGCGAGGAGGAGGGATCGGAGGGATCGCAATGCGAGGGCCAACAAGGGCGAGGGTGGCGAGGGCGCTGTC
AACGGGAAGGATAAGGGGAAAAGCCCGGACAGACGGTTTGCGGAGACGGAGATGGCCAAACCGGATGCGATAACC
GAGGCGGACGGTATCGCCGACGGTAGCGGCAGCAAGGAGCCGGCTTCGGGGCCGTTGGTGGTACTGGCATGCCGG
CACATCTTCCATATAAGCTGCCTCGAAGCGCTGCAGGACGGGCGGGAGAATGGGGGCACGGTCAGGGATAGGGGG
TTCAAGTGCCCTGTCGACGGAGGAGGGATGACGAGACCATGA
Gene >Ophio5|5876
ATGTCTGACCCAGAAGACAAGTCTCCGGCGCGAGACGAAGGCCTCGACGATGTGGACGCCGATGTGCTCCAGATG
AAGACGCACCAAGACCTGGAGACGCCCGATGCGAGCCCACGACCGTCGGCCCGGTCGCGGCGCCGGACCGGCTCC
GTGCTGAGCTCGGCGAACGCGAGCTTGGTGGATGCGCTGCCGAGAAGAGCCGGCAGTCCTGTCGACTCGCTGGCT
TCTGGTGCGGGAAACACGCCTTCTCTGCAGGCGAGTTGTGCTCTTTCTCTCTCCCCCTTCCCTTTGCTTGCGTCC
GACGTACAGCTGACGGTGTGTGTGCTTCGTGTTGCAGGGATCTCTCATGTCCTCTCCGGGGAGCAGCGTTCTCCC
CTCGGTAGCCTCTCGCCCGGGTCTCGGCAGCCCGTCGCCTTCTTTGCGGCCTTTTGATCGACGTTTTCACTCGCG
GTATTCGCCCTCGCCATCGAGCAGTCCGCGCGGCTCGTCGCCCGCCTTCCTTTCGGGCCACAGCCGGAACGTGTC
ACTGGCTTCCAACTTCCCGCTCGACCAGGCCGATACGGATACGCCGTCTGCGCCGTGGGAGGTGGTGCGATGGAC
TCGGCTCAATAAACTCAATGGCAATGCCTTTTCGGAGCTGGGCCGGCGCAACTTTGGCTCGCCGACTTGCATTGC
TGTGTCGGCTTCCATTGTGCTGGGGACGTCTAAAGGAATAATCTTAATGTTTGATTACCACCAGAATATCAAGAT
GATCATTGGCCAAGGCACGCCAGGTGAGAGCATGCCCCCTTACACAGGCTTCTTCTTTTTTTTCTTTTTTCTTTT
TTTTTTGGGCAAGACCACTACTTACCCGAACTCTCAGCTGTCGAGTCCGGCGCCGTCACGTCCATCGCCGTCTCC
GCCGACCATACCACCATCGCAGGTGGCCACGCCAATGGCAACATCTTCACCTGGGACACTTCGCGAGCGGCGCGG
CCCTTCCTTTCCATCCCTCATCTGCATGAGTCTCAGGTGCAGAACCTCGCGGCCGACGGCCACGTCCCAAACGTC
TCCGTCATCCATCTGGGATTTCTGGGGACCCGGCATACGGCCCTAGTTTCAGCCGACGATCGAGGCATGGCCTTC
TCACACCTCGCGACCAGGGGCACCGGCGCGCTCGGCAGGACCGTCAAGACGACCAGGATCCTGGGCCGATATCCA
GGCGCGCCGACGCCGGCTGGGAAGCCATTGAAACCGAGCACCGTCCTCTCTTTTGCTCCTCTGCCGCTCGGCAAC
GTAGAGCGTGCTACCGACACCATGGGCTTGACCGCAATGCTCACCCCTTACCTGCTCGTCGTCGTGTCGACGACG
CCGGTGGCCCGTACGCAGCACAAGTCGGCTCGGCCTAGAGAGGTTCCCGCCCATAGCGCCATGACCGGCTGCCTC
GCCTGGTTCCCGGCCGTGAGACTCAAGGTGCCGGATTCTGTTTCCGGCAGCGACGTGTCCAAGGCCAAGCTCGTC
TACTGCTGGTCTAACGTGCTGACGGTGCTCGACGTGGACGAGATGCCGAGTGAGGACGCTGATCAGCCTTCCTCG
CTCAAGTTCAAGGCCCGCAGCCGGTGGAAGTGCGAGGAGGCCATCGTCGCCGTGCAATGGCTGACCCGCTCCGTC
CTGACGGTGCTCACTATATCTCAGAGGCTGATTGTGCTGGAGGACGGGAGCTTGCGGATGACCGAGGCTTTTGAT
TTGCTGCAGAAACACATCTACCACACCGATCTGTTTTCCAAGCAGCTCCACAACCTGGTTGAGCAGCTCGACAAC
GACGACGAATCCATGCACGGCGTCGTAGCTGATGCCTTCTATATGAGCTTCAAGGCCTACAAGGGCAGGATCTTT
CTGCTTGGCTTCGGTGAGGTCGCCATCGGCGCCCTCGCCAACTGGGCGGACCGCCTCATTGCCATGATGGAACAC
GGCGACTACGTAGGCGCCATCCGCCTGGCGACGTCTTACTACACGGGCGACGCCGACAAGCTCACCATTGGCCTG
CCCGAGGACGCGAAGCTGCGGCACGCCATGGTTCAGGACAAGATCATGGAGATTATGGCGGCCTCGCTCAAGTAC
GCCTTCGGCCAGAGGCTCAGGAACAGCGACAATGCCGACGACAATCAGCTTCGCCGGCTCGCCGAAGCTTGCTTT
GCCGCCTGTCAGGCGATCGATACGATCGATTACCTCTTCGACGACGTGTATGAACGATACGAGACGGCCGCCGTC
GGGGCAGTCTTCCATGAGACGCTGGAGCCTTATGTCCTTGATGGGTCCATCACGTCGGTGCCGCCGGCCGTGGTC
AAGGACATGGTCGTCTACTACGTATCGCGGGGCTGGGAGGGCCGGCTAGAGGAGCTCATCTGCCACATGCAGACG
GCTACCTTTGACTTGGACCAGATGACGTCTCTCTGCAAGGAGAACAGCCTGTACGATGCGCTCATCTACGTCTGG
AACCAAGCGCTGGGCGACTACATCAGCCCGATGATGGACCTCCTGAGCTTGCTGGTGCCGCTGACGACGAACGGA
CAGCATACGACGGGAGCATCGGTGGACTACTACAGCGTCAACGCGCTCAAGATCTTTCCCTACCTGTCGTACGTC
CTGACGAGCCGGGCCTATCCGAGCGGGGAACGGATGGACGACGGGGCAGCATCCAGGGCCAAGTCGGACATCTAC
TGGTTCTTCTTTTCCGGCAAGACCATTGAGTGGCCGAGGGGCAGTGGCCGGCAACTGTTGACGCGACCCGCAGGC
GAGGACGAACCGGCGTTTCCCTACTTGCGGATGGTGCTCAAGTTTGACGCGCCCAGCTTCCTGAGCGCGCTGAAC
GAGGCGTTCGAGGACGGTTTCCTGAACGACTCGCCCGATAGGCAGGTCAACGGCGGGGCGCGCGTGGACATGCCA
GAGGAGCAAATCTTTGGTCTGACCATTAACCGCCAGTACATCGTGACGATCCTCGTCGACGTCATGAGCCCGGAG
AGCTTCGCGCCCGAGGACACCGTCTACCTCGACATGTTCATCGCTCGCAATCTGCCCAAGTTTCCGCAGTATCTT
TTGTTCTCTGGCTCGACGCTCTCCCGGGTGCTGTCCAAACTGTGCTCGTACCCGGGCGAGGACCTGGCCGAGGAT
GCCCAGCTCAGCGCCGAATACCTTTTGTCGGTCTACCAACCTTCCGACATGTCGGCCCTGATGCCGCTCTTTAAG
AAGGCGGGCTTCTACCGCATCCTCAAGCGCATCTACAAGGTAGAGAAGCAGTACGGCAAGCTCGTGGCCACATAC
TTTGAAGACGCTGATGATCAGGATGCGGTCTTTGACGCCATCTCGGATTGCCTTTTGCACCGTGGCGGTGTCGAC
GATCGTCGACGGCGTGAAGTGCTTCAAGTCGTCGAGGAGCGGGCCGGTGATCTCCTCATGCTGAGCCCGAGGCGG
GCGGCGGCCACTCTCGCGTCGCAAGGGCCCGCCTTCCACGCTCGCATCGTCGGCTCGGCGGAAGACGGGCCGGAA
CTGCAGTTCGCGTACCTCAAGGCCTTGCTTGAGCCTGACGAGGGGGCGCGCGAACAGGCCGTGGCGCCCGACCGG
CAACTGGTGGAAAACTACGTCCGTCTCATGTGTCAGTTCGAGCCCCTGCGCGTCTCCGACTACGTCGGCGCTGTG
CAGTTTGCGGACCTCCGCCTGGAGGAGCTGTTGCCGACCATGGAGGCTACGGGCGTCGTCGATGCTGCCGTCGTG
CTCATGGCGCGCGACGGCCAGGCCGAGAAGGCGCTCGAGCGGCTGGTCAGGCATCTTTTCACTCTCGAGTCTGTC
GTCCAGGGCCTCCTGGGCGGCGCCGACGAGCGTGTCGATGCCGCCCACGATTCGGTGGAGGATGTGCTTCGCGGG
ATGCAGAGATACGTCTACGTCGGCATCTGGCTGTGCCAAGGGCAATCTAAGATGTCCAAGCAGAGGGCGGTCGCC
GTCCAGAAGAACAAGCCAGAGACGCACGCGGACGAGGCCCTGTGGGTGAGTCTCATCGACGCCTGCGTTCAAGTA
ACGAAGCAACTGTCTCCGGCACTGCAAGGGCTCGCCGACGGCGCGAAGCTTGTGACGCTCCTCCGGTCACTCGTC
CAGCATACCTTTACCTCGCTGCTCAAGACGACGACCGGCCAGGCGCACGAGCAGCAGGCCAGCAAGCTCTTATCC
AACGCCGGGGCGAACCTCTCCTTCCTGCGAATCATGAGGGCTTTTCTCACGCGGGCGGCCGCCTCGTCGCCGGAC
GTGGCCGACCTGCGCGAGGTGCTCTCGTCCATCTTCGCCGCCTACGCGTACGAGGAGTCGATCCTCAAGCTATCG
AACCGGCTACTCGAGCGGAGCCTCTTTGTCAGCGTCAAGCAGGCCGTCGACCTGAGGCAGCGCGGCTGGCGGCCA
CGGGGCTCTACGTGCGAGGCTTGTGGGAGGAGGGTCTGGGGGCCTGGCGTGGCGGGCGGCGCCGTTCTCGAGGCC
TGGGAGGAGAGGCAGGCGCTCGAGGAGGCGAGGAGGAGGGATCGGAGGGATCGCAATGCGAGGGCCAACAAGGGC
GAGGGTGGCGAGGGCGCTGTCAACGGGAAGGATAAGGGGAAAAGCCCGGACAGACGGTTTGCGGAGACGGAGATG
GCCAAACCGGATGCGATAACCGAGGCGGACGGTATCGCCGACGGTAGCGGCAGCAAGGAGCCGGCTTCGGGGCCG
TTGGTGGTACTGGCATGCCGGCACATCTTCCATATAAGCTGCCTCGAAGCGCTGCAGGACGGGCGGGAGAATGGG
GGCACGGTCAGGGATAGGGGGTTCAAGTGCCCTGTCGACGGAGGAGGGATGACGAGACCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail