Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5858
Gene name
Locationscaffold_492:3164..5768
Strand+
Gene length (bp)2604
Transcript length (bp)2538
Coding sequence length (bp)2535
Protein length (aa) 845

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12751 Vac7 Vacuolar segregation subunit 7 1.0E-156 313 693

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53950|VAC7_YEAST Vacuolar segregation protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC7 PE=1 SV=1 594 818 2.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 615 637 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5858
MDKSPAVGDGATQPSADDVEPPSTANAPMLPSYPVAMPHAATSKSSRQSSATTSLTPSPESSPVANPNRQTSSVG
RSRNNSQQDRQTKPSPPVETSSLTLSSATTPNLRPANRDAQAQLPAPQKPPALQELKDSHRWPVSPRLRSPPPQL
SKPSVARRNDHDPPPLISTQRPSLSPLSPDALQHPLEPESDDLHMQSGIRTPIRGPLETVQEVSQNNSPAAPNPS
LSIDQAKDKPAGSDCQSDSALSDGGRAHGSKPSATSTHPPAGEAGASRAEMQRQSAVPPPPSLISRQSSAVSTKQ
LKPKTEGSTQTMTVETETVPSVPQVVLSTATKSESANGTLKAKPSAETIKPKKEKKKPARKQPPVNSGTGSSKAD
IFEAKIASAVDEANTSDSEETFVYDSNPPDNTERSNRRFHSRTPSATSMVSQADRNNLRSIYGVMEGGGHAHGPV
PKKSMKFVNTFGGNASDGLTPGDEDGKGTGRSAGGSARGTLRHHHHIGRWGRQPGNGHASLFDNESPFQNTAAKS
KLAGSQPRDPSGPPSPRICQSARSHLSTKRSSMQMSSSYDMDDTGADDERTPLLETTRSLRASRSRRGPHNLRQA
ESQTYTRRSSYLNRFAACLVLTIMFLLVITGAIGFMFATSQPMTDIEIVSIGNVVTSEQVLMFDLTVKAHNPNIV
VITIDHANLEIFAKSEFAKPYSYASFGDDARVQDDPLNDPPLGPGDDGDGDNDSRPNLLLGRVSSFDSSLTFEGS
LFHQGTSKSTGEMQLPYPGNNTVGGSARWVRIHQHEFDLIVKGVVKYSLPLSAHVRSATVAGRTTVKPNSANKPS
PKPNKTSTADTRHGVFAWIG
Coding >Ophio5|5858
ATGGACAAGTCACCGGCCGTGGGTGACGGCGCCACGCAACCATCTGCCGACGACGTCGAGCCCCCCTCGACTGCC
AACGCGCCCATGCTTCCCTCTTACCCAGTCGCCATGCCACACGCCGCCACCTCCAAGTCGTCGAGGCAGTCTTCG
GCCACAACCTCGCTCACACCCTCTCCAGAATCCTCTCCCGTCGCAAACCCTAACCGTCAAACGTCGTCGGTCGGA
CGCTCCCGCAACAACAGCCAGCAAGATCGTCAGACGAAGCCGTCGCCTCCCGTAGAGACGTCGTCGCTCACACTC
TCTTCCGCAACCACGCCCAACCTGCGCCCGGCCAACAGAGACGCTCAGGCCCAGCTGCCCGCTCCCCAGAAGCCA
CCGGCGCTGCAAGAGCTCAAGGATAGCCACCGCTGGCCCGTCTCGCCGCGTTTGCGATCTCCTCCCCCGCAGCTG
TCGAAACCCTCGGTAGCGCGACGAAACGACCACGACCCTCCTCCCCTCATCAGCACCCAGCGGCCCAGTCTGTCG
CCGCTGTCGCCCGACGCACTGCAACACCCTCTCGAACCTGAATCCGATGATTTACACATGCAGTCGGGCATTCGA
ACCCCCATCCGCGGTCCGCTCGAGACCGTTCAGGAGGTCAGCCAGAACAATTCTCCCGCTGCCCCCAACCCATCA
TTATCCATCGACCAAGCAAAGGACAAGCCCGCTGGTTCGGACTGCCAGTCGGACAGCGCCTTGAGCGACGGCGGC
CGGGCTCACGGCTCAAAACCTTCCGCCACGTCCACGCACCCGCCGGCCGGCGAGGCCGGTGCCTCCAGGGCCGAG
ATGCAACGCCAGTCGGCCGTTCCCCCCCCACCGAGCCTCATCTCGCGGCAGTCGAGCGCCGTCTCTACCAAGCAG
CTCAAGCCCAAGACGGAGGGCTCGACGCAAACCATGACGGTCGAGACGGAAACGGTCCCCAGCGTGCCGCAGGTC
GTGCTGTCCACGGCCACCAAGTCTGAGAGTGCAAACGGGACGCTCAAGGCCAAGCCGAGCGCTGAAACGATTAAA
CCGAAAAAAGAGAAGAAGAAGCCGGCGAGGAAGCAGCCGCCGGTAAATTCGGGAACCGGATCGTCAAAAGCCGAC
ATCTTCGAGGCCAAGATTGCCAGCGCCGTCGACGAGGCCAACACGTCAGACTCGGAGGAAACCTTCGTCTACGAT
TCTAATCCTCCAGACAACACGGAGCGATCGAATCGCAGATTTCACTCCCGCACGCCAAGCGCCACCTCCATGGTC
AGCCAGGCTGATCGAAACAACCTGCGGTCCATCTACGGCGTCATGGAAGGCGGGGGTCACGCACATGGCCCTGTC
CCCAAGAAGAGCATGAAGTTCGTTAACACGTTTGGCGGTAACGCGAGCGACGGCTTGACGCCCGGCGACGAGGAC
GGCAAGGGCACAGGCCGGAGCGCGGGCGGCTCGGCGCGTGGCACCCTGCGACATCATCACCACATCGGCAGATGG
GGCAGACAGCCAGGGAACGGCCACGCGTCACTCTTTGACAACGAGTCGCCCTTCCAGAACACGGCGGCCAAGTCG
AAGCTGGCCGGGAGCCAGCCGCGCGATCCGTCGGGACCTCCGAGCCCGAGGATATGTCAGTCGGCACGCAGCCAC
CTCAGCACCAAGCGGTCGTCGATGCAGATGTCGTCGAGTTACGACATGGACGACACGGGCGCCGACGACGAGCGG
ACGCCCCTGCTCGAGACGACGCGCTCTCTGAGGGCAAGCCGGAGCCGGCGCGGGCCTCACAACCTGCGGCAGGCC
GAGTCGCAGACGTACACGAGGCGGTCGTCGTACCTGAATCGCTTCGCCGCCTGTCTCGTTCTCACCATCATGTTC
CTCCTGGTCATCACCGGCGCCATCGGCTTCATGTTTGCCACGTCGCAGCCCATGACGGACATCGAGATTGTGTCC
ATCGGCAACGTGGTGACGAGCGAGCAGGTGCTCATGTTCGACCTGACGGTCAAAGCACACAACCCCAACATCGTC
GTCATCACCATCGACCACGCAAACCTCGAGATCTTTGCCAAGTCGGAGTTTGCGAAGCCGTACTCGTACGCGAGC
TTTGGCGACGACGCGCGCGTTCAGGACGATCCCCTCAACGATCCACCCCTGGGCCCCGGCGACGACGGCGACGGC
GACAACGACAGCAGGCCAAATCTGCTACTGGGCCGAGTCTCGTCCTTTGACAGCTCGCTCACCTTTGAAGGCTCC
CTCTTCCACCAGGGAACCTCCAAGTCGACGGGAGAGATGCAGCTGCCCTATCCGGGCAACAACACGGTCGGCGGC
TCGGCGCGATGGGTGCGCATCCACCAGCACGAGTTCGACCTGATTGTCAAGGGCGTCGTCAAATACAGCCTGCCC
TTGAGCGCCCATGTGCGGAGCGCCACGGTGGCGGGGCGGACGACTGTGAAGCCCAACTCGGCCAACAAGCCGTCG
CCGAAACCTAACAAGACGTCGACGGCCGACACTCGACACGGAGTCTTCGCCTGGATCGGA
Transcript >Ophio5|5858
ATGGACAAGTCACCGGCCGTGGGTGACGGCGCCACGCAACCATCTGCCGACGACGTCGAGCCCCCCTCGACTGCC
AACGCGCCCATGCTTCCCTCTTACCCAGTCGCCATGCCACACGCCGCCACCTCCAAGTCGTCGAGGCAGTCTTCG
GCCACAACCTCGCTCACACCCTCTCCAGAATCCTCTCCCGTCGCAAACCCTAACCGTCAAACGTCGTCGGTCGGA
CGCTCCCGCAACAACAGCCAGCAAGATCGTCAGACGAAGCCGTCGCCTCCCGTAGAGACGTCGTCGCTCACACTC
TCTTCCGCAACCACGCCCAACCTGCGCCCGGCCAACAGAGACGCTCAGGCCCAGCTGCCCGCTCCCCAGAAGCCA
CCGGCGCTGCAAGAGCTCAAGGATAGCCACCGCTGGCCCGTCTCGCCGCGTTTGCGATCTCCTCCCCCGCAGCTG
TCGAAACCCTCGGTAGCGCGACGAAACGACCACGACCCTCCTCCCCTCATCAGCACCCAGCGGCCCAGTCTGTCG
CCGCTGTCGCCCGACGCACTGCAACACCCTCTCGAACCTGAATCCGATGATTTACACATGCAGTCGGGCATTCGA
ACCCCCATCCGCGGTCCGCTCGAGACCGTTCAGGAGGTCAGCCAGAACAATTCTCCCGCTGCCCCCAACCCATCA
TTATCCATCGACCAAGCAAAGGACAAGCCCGCTGGTTCGGACTGCCAGTCGGACAGCGCCTTGAGCGACGGCGGC
CGGGCTCACGGCTCAAAACCTTCCGCCACGTCCACGCACCCGCCGGCCGGCGAGGCCGGTGCCTCCAGGGCCGAG
ATGCAACGCCAGTCGGCCGTTCCCCCCCCACCGAGCCTCATCTCGCGGCAGTCGAGCGCCGTCTCTACCAAGCAG
CTCAAGCCCAAGACGGAGGGCTCGACGCAAACCATGACGGTCGAGACGGAAACGGTCCCCAGCGTGCCGCAGGTC
GTGCTGTCCACGGCCACCAAGTCTGAGAGTGCAAACGGGACGCTCAAGGCCAAGCCGAGCGCTGAAACGATTAAA
CCGAAAAAAGAGAAGAAGAAGCCGGCGAGGAAGCAGCCGCCGGTAAATTCGGGAACCGGATCGTCAAAAGCCGAC
ATCTTCGAGGCCAAGATTGCCAGCGCCGTCGACGAGGCCAACACGTCAGACTCGGAGGAAACCTTCGTCTACGAT
TCTAATCCTCCAGACAACACGGAGCGATCGAATCGCAGATTTCACTCCCGCACGCCAAGCGCCACCTCCATGGTC
AGCCAGGCTGATCGAAACAACCTGCGGTCCATCTACGGCGTCATGGAAGGCGGGGGTCACGCACATGGCCCTGTC
CCCAAGAAGAGCATGAAGTTCGTTAACACGTTTGGCGGTAACGCGAGCGACGGCTTGACGCCCGGCGACGAGGAC
GGCAAGGGCACAGGCCGGAGCGCGGGCGGCTCGGCGCGTGGCACCCTGCGACATCATCACCACATCGGCAGATGG
GGCAGACAGCCAGGGAACGGCCACGCGTCACTCTTTGACAACGAGTCGCCCTTCCAGAACACGGCGGCCAAGTCG
AAGCTGGCCGGGAGCCAGCCGCGCGATCCGTCGGGACCTCCGAGCCCGAGGATATGTCAGTCGGCACGCAGCCAC
CTCAGCACCAAGCGGTCGTCGATGCAGATGTCGTCGAGTTACGACATGGACGACACGGGCGCCGACGACGAGCGG
ACGCCCCTGCTCGAGACGACGCGCTCTCTGAGGGCAAGCCGGAGCCGGCGCGGGCCTCACAACCTGCGGCAGGCC
GAGTCGCAGACGTACACGAGGCGGTCGTCGTACCTGAATCGCTTCGCCGCCTGTCTCGTTCTCACCATCATGTTC
CTCCTGGTCATCACCGGCGCCATCGGCTTCATGTTTGCCACGTCGCAGCCCATGACGGACATCGAGATTGTGTCC
ATCGGCAACGTGGTGACGAGCGAGCAGGTGCTCATGTTCGACCTGACGGTCAAAGCACACAACCCCAACATCGTC
GTCATCACCATCGACCACGCAAACCTCGAGATCTTTGCCAAGTCGGAGTTTGCGAAGCCGTACTCGTACGCGAGC
TTTGGCGACGACGCGCGCGTTCAGGACGATCCCCTCAACGATCCACCCCTGGGCCCCGGCGACGACGGCGACGGC
GACAACGACAGCAGGCCAAATCTGCTACTGGGCCGAGTCTCGTCCTTTGACAGCTCGCTCACCTTTGAAGGCTCC
CTCTTCCACCAGGGAACCTCCAAGTCGACGGGAGAGATGCAGCTGCCCTATCCGGGCAACAACACGGTCGGCGGC
TCGGCGCGATGGGTGCGCATCCACCAGCACGAGTTCGACCTGATTGTCAAGGGCGTCGTCAAATACAGCCTGCCC
TTGAGCGCCCATGTGCGGAGCGCCACGGTGGCGGGGCGGACGACTGTGAAGCCCAACTCGGCCAACAAGCCGTCG
CCGAAACCTAACAAGACGTCGACGGCCGACACTCGACACGGAGTCTTCGCCTGGATCGGATAG
Gene >Ophio5|5858
ATGGACAAGTCACCGGCCGTGGGTGACGGCGCCACGCAACCATCTGCCGACGACGTCGAGCCCCCCTCGACTGCC
AACGCGCCCATGCTTCCCTCTTACCCAGTCGCCATGCCACACGCCGCCACCTCCAAGTCGTCGAGGCAGTCTTCG
GCCACAACCTCGCTCACACCCTCTCCAGAATCCTCTCCCGTCGCAAACCCTAACCGTCAAACGTCGTCGGTCGGA
CGCTCCCGCAACAACAGCCAGCAAGATCGTCAGACGAAGCCGTCGCCTCCCGTAGAGACGTCGTCGCTCACACTC
TCTTCCGCAACCACGCCCAACCTGCGCCCGGCCAACAGAGACGCTCAGGCCCAGCTGCCCGCTCCCCAGAAGCCA
CCGGCGCTGCAAGAGCTCAAGGATAGCCACCGCTGGCCCGTCTCGCCGCGTTTGCGATCTCCTCCCCCGCAGCTG
TCGAAACCCTCGGTAGCGCGACGAAACGACCACGACCCTCCTCCCCTCATCAGCACCCAGCGGCCCAGTCTGTCG
CCGCTGTCGCCCGACGCACTGCAACACCCTCTCGAACCTGAATCCGATGATTTACACATGCAGTCGGGCATTCGA
ACCCCCATCCGCGGTCCGCTCGAGACCGTTCAGGAGGTCAGCCAGAACAATTCTCCCGCTGCCCCCAACCCATCA
TTATCCATCGACCAAGCAAAGGACAAGCCCGCTGGTTCGGACTGCCAGTCGGACAGCGCCTTGAGCGACGGCGGC
CGGGCTCACGGCTCAAAACCTTCCGCCACGTCCACGCACCCGCCGGCCGGCGAGGCCGGTGCCTCCAGGGCCGAG
ATGCAACGCCAGTCGGCCGTTCCCCCCCCACCGAGCCTCATCTCGCGGCAGTCGAGCGCCGTCTCTACCAAGCAG
CTCAAGCCCAAGACGGAGGGCTCGACGCAAACCATGACGGTCGAGACGGAAACGGTCCCCAGCGTGCCGCAGGTC
GTGCTGTCCACGGCCACCAAGTCTGAGAGTGCAAACGGGACGCTCAAGGCCAAGCCGAGCGCTGAAACGATTAAA
CCGAAAAAAGAGAAGAAGAAGCCGGCGAGGAAGCAGCCGCCGGTAAATTCGGGAACCGGTAAGTCGAGCTTAGTG
CTACACAAGGGTGCTTTGTTTGCTAATTGTGTCGCCACCCCGACCCTAGGATCGTCAAAAGCCGACATCTTCGAG
GCCAAGATTGCCAGCGCCGTCGACGAGGCCAACACGTCAGACTCGGAGGAAACCTTCGTCTACGATTCTAATCCT
CCAGACAACACGGAGCGATCGAATCGCAGATTTCACTCCCGCACGCCAAGCGCCACCTCCATGGTCAGCCAGGCT
GATCGAAACAACCTGCGGTCCATCTACGGCGTCATGGAAGGCGGGGGTCACGCACATGGCCCTGTCCCCAAGAAG
AGCATGAAGTTCGTTAACACGTTTGGCGGTAACGCGAGCGACGGCTTGACGCCCGGCGACGAGGACGGCAAGGGC
ACAGGCCGGAGCGCGGGCGGCTCGGCGCGTGGCACCCTGCGACATCATCACCACATCGGCAGATGGGGCAGACAG
CCAGGGAACGGCCACGCGTCACTCTTTGACAACGAGTCGCCCTTCCAGAACACGGCGGCCAAGTCGAAGCTGGCC
GGGAGCCAGCCGCGCGATCCGTCGGGACCTCCGAGCCCGAGGATATGTCAGTCGGCACGCAGCCACCTCAGCACC
AAGCGGTCGTCGATGCAGATGTCGTCGAGTTACGACATGGACGACACGGGCGCCGACGACGAGCGGACGCCCCTG
CTCGAGACGACGCGCTCTCTGAGGGCAAGCCGGAGCCGGCGCGGGCCTCACAACCTGCGGCAGGCCGAGTCGCAG
ACGTACACGAGGCGGTCGTCGTACCTGAATCGCTTCGCCGCCTGTCTCGTTCTCACCATCATGTTCCTCCTGGTC
ATCACCGGCGCCATCGGCTTCATGTTTGCCACGTCGCAGCCCATGACGGACATCGAGATTGTGTCCATCGGCAAC
GTGGTGACGAGCGAGCAGGTGCTCATGTTCGACCTGACGGTCAAAGCACACAACCCCAACATCGTCGTCATCACC
ATCGACCACGCAAACCTCGAGATCTTTGCCAAGTCGGAGTTTGCGAAGCCGTACTCGTACGCGAGCTTTGGCGAC
GACGCGCGCGTTCAGGACGATCCCCTCAACGATCCACCCCTGGGCCCCGGCGACGACGGCGACGGCGACAACGAC
AGCAGGCCAAATCTGCTACTGGGCCGAGTCTCGTCCTTTGACAGCTCGCTCACCTTTGAAGGCTCCCTCTTCCAC
CAGGGAACCTCCAAGTCGACGGGAGAGATGCAGCTGCCCTATCCGGGCAACAACACGGTCGGCGGCTCGGCGCGA
TGGGTGCGCATCCACCAGCACGAGTTCGACCTGATTGTCAAGGGCGTCGTCAAATACAGCCTGCCCTTGAGCGCC
CATGTGCGGAGCGCCACGGTGGCGGGGCGGACGACTGTGAAGCCCAACTCGGCCAACAAGCCGTCGCCGAAACCT
AACAAGACGTCGACGGCCGACACTCGACACGGAGTCTTCGCCTGGATCGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail