Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5853
Gene name
Locationscaffold_491:5654..6109
Strand-
Gene length (bp)455
Transcript length (bp)405
Coding sequence length (bp)402
Protein length (aa) 134

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.13 0.00 0.93
CcL In ants, during behavior modification 158.67 58.39 258.95
CcD In ants, recently dead 1.13 0.00 3.09

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.203598 no
SC16a CcD 1.000000 no
CcL CcD 0.020799 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5853
MKFSEVFISAICATSAAVALTTPNQGGQDLAYRSVGVEGVPAGEPLAARDLNDESALERRHPAKGKKGKKGKGAK
KGAKAAKVAKAAKAGNKKGKGKGKGKGNKANKANNNNNIQANAQNNPGLADQLNAIKGN
Coding >Ophio5|5853
ATGAAGTTCTCCGAGGTTTTCATCAGCGCCATCTGCGCCACTTCGGCTGCTGTCGCTTTGACTACGCCCAACCAG
GGTGGCCAGGACCTTGCCTACCGATCCGTCGGTGTCGAAGGCGTGCCAGCTGGAGAGCCGCTCGCAGCCAGGGAT
CTCAACGACGAGTCGGCGCTGGAGAGGAGACACCCGGCAAAGGGTAAGAAGGGCAAGAAGGGTAAGGGGGCCAAG
AAGGGGGCCAAGGCGGCCAAGGTGGCCAAGGCGGCCAAGGCAGGCAACAAGAAGGGCAAGGGCAAGGGCAAGGGC
AAGGGCAACAAAGCAAATAAGGCCAACAACAACAACAACATCCAGGCTAACGCCCAGAACAACCCAGGGCTTGCG
GATCAGTTGAACGCCATTAAGGGGAAT
Transcript >Ophio5|5853
ATGAAGTTCTCCGAGGTTTTCATCAGCGCCATCTGCGCCACTTCGGCTGCTGTCGCTTTGACTACGCCCAACCAG
GGTGGCCAGGACCTTGCCTACCGATCCGTCGGTGTCGAAGGCGTGCCAGCTGGAGAGCCGCTCGCAGCCAGGGAT
CTCAACGACGAGTCGGCGCTGGAGAGGAGACACCCGGCAAAGGGTAAGAAGGGCAAGAAGGGTAAGGGGGCCAAG
AAGGGGGCCAAGGCGGCCAAGGTGGCCAAGGCGGCCAAGGCAGGCAACAAGAAGGGCAAGGGCAAGGGCAAGGGC
AAGGGCAACAAAGCAAATAAGGCCAACAACAACAACAACATCCAGGCTAACGCCCAGAACAACCCAGGGCTTGCG
GATCAGTTGAACGCCATTAAGGGGAATTAG
Gene >Ophio5|5853
ATGAAGTTCTCCGAGGTTTTCATCAGCGCCATCTGCGCCACTTCGGCTGCTGTCGCTTTGACTACGCCCAACCAG
GGTGGCCAGGACCTTGCCTACCGATGTGAGTAAGACGGCCCCTCTCTTAAGAAATCAGACTGACAGTTGCTGTAG
CCGTCGGTGTCGAAGGCGTGCCAGCTGGAGAGCCGCTCGCAGCCAGGGATCTCAACGACGAGTCGGCGCTGGAGA
GGAGACACCCGGCAAAGGGTAAGAAGGGCAAGAAGGGTAAGGGGGCCAAGAAGGGGGCCAAGGCGGCCAAGGTGG
CCAAGGCGGCCAAGGCAGGCAACAAGAAGGGCAAGGGCAAGGGCAAGGGCAAGGGCAACAAAGCAAATAAGGCCA
ACAACAACAACAACATCCAGGCTAACGCCCAGAACAACCCAGGGCTTGCGGATCAGTTGAACGCCATTAAGGGGA
ATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail